Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTKO05K3)

• DOT Name: Musculoskeletal embryonic nuclear protein 1 (MUSTN1)
• Gene Name: MUSTN1
• Related Disease:
  Appendicitis
  Breast cancer
  Breast carcinoma
• UniProt ID: MSTN1_HUMAN
• Pfam ID: PF15682
• Sequence:
  MSQAGAQEAPIKKKRPPVKDEDLKGARGNLTKNQEIKSKTYQVMRECEQAGSAAPSVFSR
  TRTGTETVFEKPKAGPTKSVFG
• Function: May be involved in the development and regeneration of the musculoskeletal system.

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Appendicitis	DIS4GOLF	Strong	Biomarker	[1]
Breast cancer	DIS7DPX1	Limited	Genetic Variation	[2]
Breast carcinoma	DIS2UE88	Limited	Genetic Variation	[2]

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Musculoskeletal embryonic nuclear protein 1 (MUSTN1).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Musculoskeletal embryonic nuclear protein 1 (MUSTN1).	[4]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Musculoskeletal embryonic nuclear protein 1 (MUSTN1).	[5]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Musculoskeletal embryonic nuclear protein 1 (MUSTN1).	[6]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Musculoskeletal embryonic nuclear protein 1 (MUSTN1).	[7]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Musculoskeletal embryonic nuclear protein 1 (MUSTN1).	[8]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Musculoskeletal embryonic nuclear protein 1 (MUSTN1).	[9]

References

• [1] Complicated Appendicitis: Are Extended Antibiotics Necessary? A Post Hoc Analysis of the EAST Appendicitis "MUSTANG" Study.J Surg Res. 2020 Mar;247:508-513. doi: 10.1016/j.jss.2019.09.054. Epub 2019 Dec 4.
• [2] MicroRNA related polymorphisms and breast cancer risk.PLoS One. 2014 Nov 12;9(11):e109973. doi: 10.1371/journal.pone.0109973. eCollection 2014.
• [3] Design principles of concentration-dependent transcriptome deviations in drug-exposed differentiating stem cells. Chem Res Toxicol. 2014 Mar 17;27(3):408-20.
• [4] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [5] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [6] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [7] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [8] Inter- and intra-laboratory study to determine the reproducibility of toxicogenomics datasets. Toxicology. 2011 Nov 28;290(1):50-8.
• [9] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.