Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTKRUPGV)

DOT Name Homeobox protein Hox-D12 (HOXD12)
Synonyms Homeobox protein Hox-4H
Gene Name HOXD12
Related Disease
Clubfoot ( )
Congenital deformities of limbs ( )
Melanoma ( )
Syndactyly ( )
UniProt ID
HXD12_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00046
Sequence
MCERSLYRAGYVGSLLNLQSPDSFYFSNLRPNGGQLAALPPISYPRGALPWAATPASCAP
AQPAGATAFGGFSQPYLAGSGPLGLQPPTAKDGPEEQAKFYAPEAAAGPEERGRTRPSFA
PESSLAPAVAALKAAKYDYAGVGRATPGSTTLLQGAPCAPGFKDDTKGPLNLNMTVQAAG
VASCLRPSLPDGLPWGAAPGRARKKRKPYTKQQIAELENEFLVNEFINRQKRKELSNRLN
LSDQQVKIWFQNRRMKKKRVVLREQALALY
Function Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Clubfoot DISLXT4S Strong Biomarker [1]
Congenital deformities of limbs DISP4N1Q Strong Biomarker [2]
Melanoma DIS1RRCY Strong Biomarker [3]
Syndactyly DISZK2BT Strong Biomarker [4]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Homeobox protein Hox-D12 (HOXD12). [5]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Homeobox protein Hox-D12 (HOXD12). [6]
------------------------------------------------------------------------------------

References

1 [Analysis of association between 5' HOXD gene and idiopathic congenital talipes equinovarus].Zhonghua Yi Xue Yi Chuan Xue Za Zhi. 2005 Dec;22(6):653-6.
2 Point mutation of Hoxd12 in mice.Yonsei Med J. 2008 Dec 31;49(6):965-72. doi: 10.3349/ymj.2008.49.6.965.
3 Silencing of Peroxiredoxin 2 and aberrant methylation of 33 CpG islands in putative promoter regions in human malignant melanomas.Cancer Res. 2006 Jun 15;66(12):6080-6. doi: 10.1158/0008-5472.CAN-06-0157.
4 Duplication at chromosome 2q31.1-q31.2 in a family presenting syndactyly and nystagmus.Eur J Hum Genet. 2011 Nov;19(11):1198-201. doi: 10.1038/ejhg.2011.95. Epub 2011 Jun 8.
5 Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
6 Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.