Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTLDQW51)

• DOT Name: Sterile alpha motif domain-containing protein 14 (SAMD14)
• Synonyms: SAM domain-containing protein 14
• Gene Name: SAMD14
• Related Disease:
  Neoplasm
  Anemia
  Beta thalassemia
  Central nervous system lymphoma
  Adenocarcinoma
  Adenocarcinoma in situ
• UniProt ID: SAM14_HUMAN
• Pfam ID: PF07647
• Sequence:
  MASSKLREPVDEVFDLDLAVPETARLDSSLHKARAQLLAKGRRHRPSRSRLRDSASSAED
  GEGSDGPGGKVTDGCGSPLHRLRSPLHSGPGSPAGGSFCLDPPGLRRSLDEDEPPPSPLT
  RYRPLHNAASHEGLAAASCSPPRSAPSSDSSPSFVRRHPRAEPHSEDDSRDASPPEPASP
  TIGLDKKTRRKFLDLGVTLRRASTGKSRKEKGSNRLSMGSRESVEGSGRSGGSPFLPFSW
  FTDSGKGSASSGSTTSPTCSPKHEGFSPKKSASQESTLSDDSTPPSSSPKIPSGPWQEAK
  CSYPYHTLSQSSDEFLDEPLPPVHHWTSQQVGQWLQSLNLEQYAAEFAARQVDGPQLLQL
  DGSKLKSLGLSNSHDRALVKRKLKEMAAAAEKERKAQEKAARQREKLRRREQEAKKS

Molecular Interaction Atlas (MIA) of This DOT

6 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Neoplasm	DISZKGEW	Definitive	Genetic Variation	[1]
Anemia	DISTVL0C	Strong	Biomarker	[2]
Beta thalassemia	DIS5RCQK	Strong	Biomarker	[2]
Central nervous system lymphoma	DISBYQTA	Strong	Biomarker	[3]
Adenocarcinoma	DIS3IHTY	Limited	Posttranslational Modification	[4]
Adenocarcinoma in situ	DISSTE29	Limited	Posttranslational Modification	[4]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Sterile alpha motif domain-containing protein 14 (SAMD14).	[5]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Sterile alpha motif domain-containing protein 14 (SAMD14).	[6]

References

• [1] Boswellic acid induces epigenetic alterations by modulating DNA methylation in colorectal cancer cells.Cancer Biol Ther. 2012 May;13(7):542-52. doi: 10.4161/cbt.19604. Epub 2012 May 1.
• [2] GATA Factor-Regulated Samd14 Enhancer Confers Red Blood Cell Regeneration and Survival in Severe Anemia.Dev Cell. 2017 Aug 7;42(3):213-225.e4. doi: 10.1016/j.devcel.2017.07.009.
• [3] Hyper-N-glycosylated SAMD14 and neurabin-I as driver autoantigens of primary central nervous system lymphoma.Blood. 2018 Dec 27;132(26):2744-2753. doi: 10.1182/blood-2018-03-836932. Epub 2018 Sep 24.
• [4] Frequent aberrant methylation of the promoter region of sterile alpha motif domain 14 in pulmonary adenocarcinoma.Cancer Sci. 2008 Nov;99(11):2177-84. doi: 10.1111/j.1349-7006.2008.00965.x. Epub 2008 Sep 22.
• [5] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.