Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTLEGQIH)

• DOT Name: CGG triplet repeat-binding protein 1 (CGGBP1)
• Synonyms: CGG-binding protein 1; 20 kDa CGG-binding protein; p20-CGGBP DNA-binding protein
• Gene Name: CGGBP1
• Related Disease:
  Advanced cancer
  Squamous cell carcinoma
• UniProt ID: CGBP1_HUMAN
• Sequence:
  MERFVVTAPPARNRSKTALYVTPLDRVTEFGGELHEDGGKLFCTSCNVVLNHVRKSAISD
  HLKSKTHTKRKAEFEEQNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEK
  ADHPAVRAFLSRHVKNGGSIPKSDQLRRAYLPDGYENENQLLNSQDC
• Function: Binds to nonmethylated 5'-d(CGG)(n)-3' trinucleotide repeats in the FMR1 promoter. May play a role in regulating FMR1 promoter.
• Tissue Specificity: Ubiquitous. Highly expressed in placenta, thymus, lymph nodes, cerebellum and cerebral cortex. Low expression in other regions of the brain.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	moderate	Biomarker	[1]
Squamous cell carcinoma	DISQVIFL	moderate	Biomarker	[2]

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of CGG triplet repeat-binding protein 1 (CGGBP1).	[3]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of CGG triplet repeat-binding protein 1 (CGGBP1).	[4]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of CGG triplet repeat-binding protein 1 (CGGBP1).	[5]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of CGG triplet repeat-binding protein 1 (CGGBP1).	[6]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of CGG triplet repeat-binding protein 1 (CGGBP1).	[7]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of CGG triplet repeat-binding protein 1 (CGGBP1).	[8]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of CGG triplet repeat-binding protein 1 (CGGBP1).	[9]

References

• [1] CGGBP1--an indispensable protein with ubiquitous cytoprotective functions.Ups J Med Sci. 2015;120(4):219-32. doi: 10.3109/03009734.2015.1086451.
• [2] Novel tumor suppressor candidates on chromosome 3 revealed by NotI-microarrays in cervical cancer.Epigenetics. 2013 Apr;8(4):409-20. doi: 10.4161/epi.24233. Epub 2013 Mar 11.
• [3] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [4] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [5] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [6] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [7] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [8] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [9] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.