Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTLS95WO)

• DOT Name: Mitochondrial coiled-coil domain protein 1 (MCCD1)
• Gene Name: MCCD1
• Related Disease:
  Disorder of methionine catabolism
  Methionine adenosyltransferase deficiency
  Methylmalonic acidemia
  Phenylketonuria
  Multiple sclerosis
  Rheumatoid arthritis
• UniProt ID: MCCD1_HUMAN
• Pfam ID: PF15707
• Sequence:
  MVLPLPWLSRYHFLRLLLPSWSLAPQGSHGCCSQNPKASMEEQTSSRGNGKMTSPPRGPG
  THRTAELARAEELLEQQLELYQALLEGQEGAWEAQALVLKIQKLKEQMRRHQESLGGGA
• Tissue Specificity: Widely expressed. Expressed in adult and fetal liver, kidney and lung. Expressed in fetal brain. Weakly expressed in fetal spleen.

Molecular Interaction Atlas (MIA) of This DOT

6 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Disorder of methionine catabolism	DISC7OZE	Definitive	Genetic Variation	[1]
Methionine adenosyltransferase deficiency	DIS4SI69	Definitive	Genetic Variation	[1]
Methylmalonic acidemia	DISHY8VB	Definitive	Biomarker	[1]
Phenylketonuria	DISCU56J	Definitive	Genetic Variation	[1]
Multiple sclerosis	DISB2WZI	Strong	Genetic Variation	[2]
Rheumatoid arthritis	DISTSB4J	Strong	Genetic Variation	[3]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Mitochondrial coiled-coil domain protein 1 (MCCD1).	[4]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Mitochondrial coiled-coil domain protein 1 (MCCD1).	[5]

References

• [1] Expanded Newborn Screening for Inborn Errors of Metabolism by Tandem Mass Spectrometry in Suzhou, China: Disease Spectrum, Prevalence, Genetic Characteristics in a Chinese Population.Front Genet. 2019 Oct 29;10:1052. doi: 10.3389/fgene.2019.01052. eCollection 2019.
• [2] Risk alleles for multiple sclerosis identified by a genomewide study.N Engl J Med. 2007 Aug 30;357(9):851-62. doi: 10.1056/NEJMoa073493. Epub 2007 Jul 29.
• [3] A genome-wide association study suggests contrasting associations in ACPA-positive versus ACPA-negative rheumatoid arthritis.Ann Rheum Dis. 2011 Feb;70(2):259-65. doi: 10.1136/ard.2009.126821. Epub 2010 Dec 14.
• [4] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.