Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTMAAJ4O)

• DOT Name: Uncharacterized protein C7orf57 (C7ORF57)
• Gene Name: C7ORF57
• UniProt ID: CG057_HUMAN
• Pfam ID: PF17662
• Sequence:
  MRNTSKELQGATHRYAPCDWYYHVPVKRSEKAVDAPPASQIPGLSNLGDSHSENLPGTRR
  YWIKETDSEYVKLAKQGGRPDLLKHFAPGTRKGSPVAYSLPDWYIHHSKPPTASQQEVRA
  VSMPDYMVHEEFNPDQANGSYASRRGPFDFDMKTVWQREAEELEKEKKKLRLPAIDSKYL
  SKAGTPLGPKNPAGSRLSFPPVPGQKNSSPTNFSKLISNGYKDEWLQQQQRADSDKRTPK
  TSRASVLSQSPRDLEGPQDAARLQDAEASEGPEDTPESSQSPEESVSASTPAELK

Molecular Interaction Atlas (MIA) of This DOT

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Uncharacterized protein C7orf57 (C7ORF57).	[1]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Uncharacterized protein C7orf57 (C7ORF57).	[2]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Uncharacterized protein C7orf57 (C7ORF57).	[3]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Uncharacterized protein C7orf57 (C7ORF57).	[4]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Uncharacterized protein C7orf57 (C7ORF57).	[5]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Uncharacterized protein C7orf57 (C7ORF57).	[6]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [3] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [4] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [6] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.