Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTMMY5OE)
DOT Name | Piercer of microtubule wall 2 protein (PIERCE2) | ||||
---|---|---|---|---|---|
Gene Name | PIERCE2 | ||||
UniProt ID | |||||
3D Structure | |||||
PDB ID | |||||
Pfam ID | |||||
Sequence |
MTDRNRDKKSTSPSNSDTEMKSEQLPPCVNPGNPVFSCMLDPKTLQTATSLSKPQMIMYK
TNSSHYGEFLPIPQFFPCNYTPKEQVFSSHIRATGFYQNNTLNTAPDRTRTLDFPNIQHT L |
||||
Function | Microtubule inner protein involved in the attachment of outer dynein arms (ODAs) to dynein-decorated doublet microtubules (DMTs) in cilia axoneme, which is required for motile cilia beating. | ||||
Tissue Specificity | Expressed in airway epithelial cells. | ||||
Molecular Interaction Atlas (MIA) of This DOT
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
4 Drug(s) Affected the Gene/Protein Processing of This DOT
|
||||||||||||||||||||||||||||||||||||||||
References