General Information of Drug Off-Target (DOT) (ID: OTMMY5OE)

DOT Name Piercer of microtubule wall 2 protein (PIERCE2)
Gene Name PIERCE2
UniProt ID
PIRC2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
7UNG; 8J07
Pfam ID
PF14892
Sequence
MTDRNRDKKSTSPSNSDTEMKSEQLPPCVNPGNPVFSCMLDPKTLQTATSLSKPQMIMYK
TNSSHYGEFLPIPQFFPCNYTPKEQVFSSHIRATGFYQNNTLNTAPDRTRTLDFPNIQHT
L
Function Microtubule inner protein involved in the attachment of outer dynein arms (ODAs) to dynein-decorated doublet microtubules (DMTs) in cilia axoneme, which is required for motile cilia beating.
Tissue Specificity Expressed in airway epithelial cells.

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
4 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Piercer of microtubule wall 2 protein (PIERCE2). [1]
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Piercer of microtubule wall 2 protein (PIERCE2). [2]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Piercer of microtubule wall 2 protein (PIERCE2). [3]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Piercer of microtubule wall 2 protein (PIERCE2). [4]
------------------------------------------------------------------------------------

References

1 Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
2 Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
3 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
4 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.