Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTN74HD4)

DOT Name	Alanyl-tRNA editing protein Aarsd1 (PTGES3L-AARSD1)
Synonyms	Alanyl-tRNA synthetase domain-containing protein 1
Gene Name	PTGES3L-AARSD1
UniProt ID	AASD1_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF07973
Sequence	MAFWCQRDSYAREFTTTVVSCCPAELQTEGSNGKKEVLSGFQVVLEDTVLFPEGGGQPDD RGTINDISVLRVTRRGEQADHFTQTPLDPGSQVLVRVDWERRFDHMQQHSGQHLITAVAD HLFKLKTTSWELGRFRSAIELDTPSMTAEQVAAIEQSVNEKIRDRLPVNVRELSLDDPEV EQVSGRGLPDDHAGPIRVVNIEGVDSNMCCGTHVSNLSDLQVIKILGTEKGKKNRTNLIF LSGNRVLKWMERSHGTEKALTALLKCGAEDHVEAVKKLQNSTKILQKNNLNLLRDLAVHI AHSLRNSPDWGGVVILHRKEGDSEFMNIIANEIGSEETLLFLTVGDEKGGGLFLLAGPPA SVETLGPRVAEVLEGKGAGKKGRFQGKATKMSRRMEAQALLQDYISTQSAKE
Function	Functions in trans to edit the amino acid moiety from incorrectly charged tRNA(Ala).

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Alanyl-tRNA editing protein Aarsd1 (PTGES3L-AARSD1).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Alanyl-tRNA editing protein Aarsd1 (PTGES3L-AARSD1).	[8]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Alanyl-tRNA editing protein Aarsd1 (PTGES3L-AARSD1).	[9]
------------------------------------------------------------------------------------

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Alanyl-tRNA editing protein Aarsd1 (PTGES3L-AARSD1).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Alanyl-tRNA editing protein Aarsd1 (PTGES3L-AARSD1).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Alanyl-tRNA editing protein Aarsd1 (PTGES3L-AARSD1).	[4]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Alanyl-tRNA editing protein Aarsd1 (PTGES3L-AARSD1).	[5]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Alanyl-tRNA editing protein Aarsd1 (PTGES3L-AARSD1).	[6]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Alanyl-tRNA editing protein Aarsd1 (PTGES3L-AARSD1).	[7]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Alanyl-tRNA editing protein Aarsd1 (PTGES3L-AARSD1).	[10]
------------------------------------------------------------------------------------


⏷ Show the Full List of 7 Drug(s)

References

1	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2	Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
3	Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
4	Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
5	Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
6	Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
7	Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
8	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
9	Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
10	Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.