Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTN85925)

• DOT Name: MAP7 domain-containing protein 2 (MAP7D2)
• Gene Name: MAP7D2
• UniProt ID: MA7D2_HUMAN
• Pfam ID: PF05672
• Sequence:
  MERGGGGSGTGSRPEGTARGTSLPGKIAEPGAVRTSQPNYRPQGMEGFLKSDERQRLAKE
  RREEREKCLAAREQQILEKQKRARLQYEKQMEERWRKLEEQRQREDQKRAAVEEKRKQKL
  REEEERLEAMMRRSLERTQQLELKKKYSWGAPLAIGPGGHDACDKLSTSTMSLPKPTEPP
  MNKRLSSSTVAISYSPDRVFHVCPRLAPLGPLNPSYKSSPTRNIEKKKATSTSTSGAGDV
  GKEALSGGEASLVEKVKRGQRTATSLPVVNFGSPLRRCEFSGGIPKRPSSPVISKTATKA
  YPQSPKTTKPPYPGSPVKYRLPALSGQDMPKRKAEKEKSNKEREGTLAQQAAGPQGEEAL
  EKHVVDKHASEKHAAAAGGKAENSAALGKPTAGTTDAGEAAKILAEKRRQARLQKEQEEQ
  ERLEKEEQDRLEREELKRKAEEERLRLEEEARKQEEERKRQEEEKKKQEGEEKRKAGEEA
  KRKAEEELLLKEKQEQEKQEKAMIEKQKEAAETKAREVAEQMRLEREQIMLQIEQERLER
  KKRIDEIMKRTRKSDVSPQVKKEDPKVGVQPAVCVEKKTKLVVPNKMEINGLNTCQEVNG
  VDHAAPETYPQDIFSNGLKPAGGLIHLDALDGKSNSLDDSTEEVQSMDVSPVSKEELISI
  PEFSPVSEMIPGVSLDQNGTGNARALQDLLDFTGPPTFPKRSSENLSLDDCNKNLIEGFN
  SPGQETPLNTFC

Molecular Interaction Atlas (MIA) of This DOT

13 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of MAP7 domain-containing protein 2 (MAP7D2).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of MAP7 domain-containing protein 2 (MAP7D2).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of MAP7 domain-containing protein 2 (MAP7D2).	[3]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of MAP7 domain-containing protein 2 (MAP7D2).	[4]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of MAP7 domain-containing protein 2 (MAP7D2).	[5]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of MAP7 domain-containing protein 2 (MAP7D2).	[5]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of MAP7 domain-containing protein 2 (MAP7D2).	[6]
Hydroquinone	DM6AVR4	Approved	Hydroquinone decreases the expression of MAP7 domain-containing protein 2 (MAP7D2).	[7]
Belinostat	DM6OC53	Phase 2	Belinostat decreases the expression of MAP7 domain-containing protein 2 (MAP7D2).	[8]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of MAP7 domain-containing protein 2 (MAP7D2).	[9]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of MAP7 domain-containing protein 2 (MAP7D2).	[11]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of MAP7 domain-containing protein 2 (MAP7D2).	[12]
KOJIC ACID	DMP84CS	Investigative	KOJIC ACID decreases the expression of MAP7 domain-containing protein 2 (MAP7D2).	[13]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of MAP7 domain-containing protein 2 (MAP7D2).	[10]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [4] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [5] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [6] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [7] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [8] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [9] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [10] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [11] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [12] Cystathionine metabolic enzymes play a role in the inflammation resolution of human keratinocytes in response to sub-cytotoxic formaldehyde exposure. Toxicol Appl Pharmacol. 2016 Nov 1;310:185-194.
• [13] Toxicogenomics of kojic acid on gene expression profiling of a375 human malignant melanoma cells. Biol Pharm Bull. 2006 Apr;29(4):655-69.