Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTNC55HX)

• DOT Name: Solute carrier family 2, facilitated glucose transporter member 11 (SLC2A11)
• Synonyms: Glucose transporter type 11; GLUT-11
• Gene Name: SLC2A11
• UniProt ID: GTR11_HUMAN
• Pfam ID: PF00083
• Sequence:
  MRALRRLIQGRILLLTICAAGIGGTFQFGYNLSIINAPTLHIQEFTNETWQARTGEPLPD
  HLVLLMWSLIVSLYPLGGLFGALLAGPLAITLGRKKSLLVNNIFVVSAAILFGFSRKAGS
  FEMIMLGRLLVGVNAGVSMNIQPMYLGESAPKELRGAVAMSSAIFTALGIVMGQVVGLRE
  LLGGPQAWPLLLASCLVPGALQLASLPLLPESPRYLLIDCGDTEACLAALRRLRGSGDLA
  GELEELEEERAACQGCRARRPWELFQHRALRRQVTSLVVLGSAMELCGNDSVYAYASSVF
  RKAGVPEAKIQYAIIGTGSCELLTAVVSCVVIERVGRRVLLIGGYSLMTCWGSIFTVALC
  LQSSFPWTLYLAMACIFAFILSFGIGPAGVTGILATELFDQMARPAACMVCGALMWIMLI
  LVGLGFPFIMEALSHFLYVPFLGVCVCGAIYTGLFLPETKGKTFQEISKELHRLNFPRRA
  QGPTWRSLEVIQSTEL
• Function: Facilitative glucose transporter.
• Tissue Specificity: Expressed in heart and skeletal muscle.
• Reactome Pathway: Cellular hexose transport (R-HSA-189200)

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Regulation of Drug Effects of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Fructose	DM43AN2	Approved	Solute carrier family 2, facilitated glucose transporter member 11 (SLC2A11) increases the transport of Fructose.	[6]
D-glucose	DMMG2TO	Investigative	Solute carrier family 2, facilitated glucose transporter member 11 (SLC2A11) increases the transport of D-glucose.	[6]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Solute carrier family 2, facilitated glucose transporter member 11 (SLC2A11).	[1]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Solute carrier family 2, facilitated glucose transporter member 11 (SLC2A11).	[2]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Solute carrier family 2, facilitated glucose transporter member 11 (SLC2A11).	[1]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Solute carrier family 2, facilitated glucose transporter member 11 (SLC2A11).	[1]
Cidofovir	DMA13GD	Approved	Cidofovir affects the expression of Solute carrier family 2, facilitated glucose transporter member 11 (SLC2A11).	[1]
Zidovudine	DM4KI7O	Approved	Zidovudine increases the expression of Solute carrier family 2, facilitated glucose transporter member 11 (SLC2A11).	[3]
Clodronate	DM9Y6X7	Approved	Clodronate increases the expression of Solute carrier family 2, facilitated glucose transporter member 11 (SLC2A11).	[1]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Solute carrier family 2, facilitated glucose transporter member 11 (SLC2A11).	[5]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Solute carrier family 2, facilitated glucose transporter member 11 (SLC2A11).	[4]

References

• [1] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [2] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [3] Differential gene expression in human hepatocyte cell lines exposed to the antiretroviral agent zidovudine. Arch Toxicol. 2014 Mar;88(3):609-23. doi: 10.1007/s00204-013-1169-3. Epub 2013 Nov 30.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [5] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [6] A highly conserved hydrophobic motif in the exofacial vestibule of fructose transporting SLC2A proteins acts as a critical determinant of their substrate selectivity. Mol Membr Biol. 2007 Sep-Dec;24(5-6):455-63. doi: 10.1080/09687680701298143.