Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTNLKLNA)

• DOT Name: Protein TEX261 (TEX261)
• Gene Name: TEX261
• UniProt ID: TX261_HUMAN
• Pfam ID: PF04148
• Sequence:
  MWFMYLLSWLSLFIQVAFITLAVAAGLYYLAELIEEYTVATSRIIKYMIWFSTAVLIGLY
  VFERFPTSMIGVGLFTNLVYFGLLQTFPFIMLTSPNFILSCGLVVVNHYLAFQFFAEEYY
  PFSEVLAYFTFCLWIIPFAFFVSLSAGENVLPSTMQPGDDVVSNYFTKGKRGKRLGILVV
  FSFIKEAILPSRQKIY

Molecular Interaction Atlas (MIA) of This DOT

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Protein TEX261 (TEX261).	[1]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Protein TEX261 (TEX261).	[2]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Protein TEX261 (TEX261).	[3]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Protein TEX261 (TEX261).	[4]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Protein TEX261 (TEX261).	[5]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [3] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [4] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [5] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.