Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTNTYJHP)

DOT Name	Cerebellin-3 (CBLN3)
Gene Name	CBLN3
UniProt ID	CBLN3_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF00386
Sequence	MLGAKPHWLPGPLHSPGLPLVLVLLALGAGWAQEGSEPVLLEGECLVVCEPGRAAAGGPG GAALGEAPPGRVAFAAVRSHHHEPAGETGNGTSGAIYFDQVLVNEGGGFDRASGSFVAPV RGVYSFRFHVVKVYNRQTVQVSLMLNTWPVISAFANDPDVTREAATSSVLLPLDPGDRVS LRLRRGNLLGGWKYSSFSGFLIFPL
Function	May be involved in synaptic functions in the CNS.

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Cerebellin-3 (CBLN3).	[1]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Cerebellin-3 (CBLN3).	[2]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Cerebellin-3 (CBLN3).	[3]
GSK2110183	DMZHB37	Phase 2	GSK2110183 increases the expression of Cerebellin-3 (CBLN3).	[4]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Cerebellin-3 (CBLN3).	[5]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Cerebellin-3 (CBLN3).	[6]
------------------------------------------------------------------------------------


⏷ Show the Full List of 6 Drug(s)

References

1	Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
2	17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
3	Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
4	Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
5	Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
6	Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.