| DOT Name |
Histone H2B type 1-A (H2BC1)
|
| Synonyms |
Histone H2B, testis; TSH2B.1; hTSH2B; Testis-specific histone H2B |
| Gene Name |
H2BC1
|
| Related Disease |
- Gout ( )
- Tuberculosis ( )
|
| UniProt ID |
|
| 3D Structure |
|
| PDB ID |
|
| Pfam ID |
|
| Sequence |
MPEVSSKGATISKKGFKKAVVKTQKKEGKKRKRTRKESYSIYIYKVLKQVHPDTGISSKA
MSIMNSFVTDIFERIASEASRLAHYSKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAV
TKYTSSK
|
| Function |
Variant histone specifically required to direct the transformation of dissociating nucleosomes to protamine in male germ cells. Entirely replaces classical histone H2B prior nucleosome to protamine transition and probably acts as a nucleosome dissociating factor that creates a more dynamic chromatin, facilitating the large-scale exchange of histones. Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Also found in fat cells, its function and the presence of post-translational modifications specific to such cells are still unclear.
|
| Tissue Specificity |
Mainly expressed in testis, and the corresponding protein is also present in mature sperm (at protein level). Also found in some fat cells. |
| KEGG Pathway |
- Neutrophil extracellular trap formation (hsa04613 )
- Alcoholism (hsa05034 )
- Viral carcinogenesis (hsa05203 )
- Systemic lupus erythematosus (hsa05322 )
|
| Reactome Pathway |
- Cleavage of the damaged pyrimidine (R-HSA-110329 )
- Recognition and association of DNA glycosylase with site containing an affected purine (R-HSA-110330 )
- Cleavage of the damaged purine (R-HSA-110331 )
- Meiotic synapsis (R-HSA-1221632 )
- Packaging Of Telomere Ends (R-HSA-171306 )
- Pre-NOTCH Transcription and Translation (R-HSA-1912408 )
- Formation of the beta-catenin (R-HSA-201722 )
- PRC2 methylates histones and DNA (R-HSA-212300 )
- Condensation of Prophase Chromosomes (R-HSA-2299718 )
- Oxidative Stress Induced Senescence (R-HSA-2559580 )
- Senescence-Associated Secretory Phenotype (SASP) (R-HSA-2559582 )
- DNA Damage/Telomere Stress Induced Senescence (R-HSA-2559586 )
- HDACs deacetylate histones (R-HSA-3214815 )
- HATs acetylate histones (R-HSA-3214847 )
- SIRT1 negatively regulates rRNA expression (R-HSA-427359 )
- ERCC6 (CSB) and EHMT2 (G9a) positively regulate rRNA expression (R-HSA-427389 )
- NoRC negatively regulates rRNA expression (R-HSA-427413 )
- B-WICH complex positively regulates rRNA expression (R-HSA-5250924 )
- DNA methylation (R-HSA-5334118 )
- Transcriptional regulation by small RNAs (R-HSA-5578749 )
- Activation of anterior HOX genes in hindbrain development during early embryogenesis (R-HSA-5617472 )
- Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3 (R-HSA-5625886 )
- Ub-specific processing proteases (R-HSA-5689880 )
- Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks (R-HSA-5693565 )
- Nonhomologous End-Joining (NHEJ) (R-HSA-5693571 )
- Processing of DNA double-strand break ends (R-HSA-5693607 )
- Deposition of new CENPA-containing nucleosomes at the centromere (R-HSA-606279 )
- Assembly of the ORC complex at the origin of replication (R-HSA-68616 )
- G2/M DNA damage checkpoint (R-HSA-69473 )
- RNA Polymerase I Promoter Opening (R-HSA-73728 )
- RNA Polymerase I Promoter Escape (R-HSA-73772 )
- E3 ubiquitin ligases ubiquitinate target proteins (R-HSA-8866654 )
- RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function (R-HSA-8936459 )
- RUNX1 regulates transcription of genes involved in differentiation of HSCs (R-HSA-8939236 )
- Estrogen-dependent gene expression (R-HSA-9018519 )
- Meiotic recombination (R-HSA-912446 )
- HCMV Early Events (R-HSA-9609690 )
- HCMV Late Events (R-HSA-9610379 )
- Transcriptional regulation of granulopoiesis (R-HSA-9616222 )
- Inhibition of DNA recombination at telomere (R-HSA-9670095 )
- Defective pyroptosis (R-HSA-9710421 )
- Amyloid fiber formation (R-HSA-977225 )
- Chromatin modifications during the maternal to zygotic transition (MZT) (R-HSA-9821002 )
- Replacement of protamines by nucleosomes in the male pronucleus (R-HSA-9821993 )
- Recognition and association of DNA glycosylase with site containing an affected pyrimidine (R-HSA-110328 )
|
|
|
|
|
|
|
