Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTO126A1)

• DOT Name: Keratinocyte-associated transmembrane protein 2 (C5ORF15)
• Gene Name: C5ORF15
• UniProt ID: KCT2_HUMAN
• Pfam ID: PF17818
• Sequence:
  MAAAVPKRMRGPAQAKLLPGSAIQALVGLARPLVLALLLVSAALSSVVSRTDSPSPTVLN
  SHISTPNVNALTHENQTKPSISQISTTLPPTTSTKKSGGASVVPHPSPTPLSQEEADNNE
  DPSIEEEDLLMLNSSPSTAKDTLDNGDYGEPDYDWTTGPRDDDESDDTLEENRGYMEIEQ
  SVKSFKMPSSNIEEEDSHFFFHLIIFAFCIAVVYITYHNKRKIFLLVQSRKWRDGLCSKT
  VEYHRLDQNVNEAMPSLKITNDYIF
• Tissue Specificity: Widely expressed.

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Vinblastine	DM5TVS3	Approved	Keratinocyte-associated transmembrane protein 2 (C5ORF15) affects the response to substance of Vinblastine.	[5]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Keratinocyte-associated transmembrane protein 2 (C5ORF15).	[1]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Keratinocyte-associated transmembrane protein 2 (C5ORF15).	[2]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Keratinocyte-associated transmembrane protein 2 (C5ORF15).	[3]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Keratinocyte-associated transmembrane protein 2 (C5ORF15).	[4]

References

• [1] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [2] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [3] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [5] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.