Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTOALKQN)

• DOT Name: Odontogenesis associated phosphoprotein (ODAPH)
• Gene Name: ODAPH
• Related Disease:
  Amelogenesis imperfecta
  Amelogenesis imperfecta hypomaturation type 2A4
  Amelogenesis imperfecta type 2
• UniProt ID: ODAPH_HUMAN
• Pfam ID: PF15848
• Sequence:
  MARRHCFSYWLLVCWLVVTVAEGQEEVFTPPGDSQNNADATDCQIFTLTPPPAPRSPVTR
  AQPITKTPRCPFHFFPRRPRIHFRFPNRPFVPSRCNHRFPFQPFYWPHRYLTYRYFPRRR
  LQRGSSSEES
• Function: May promote nucleation of hydroxyapatite.
• Tissue Specificity: Highly expressed in placenta.

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Amelogenesis imperfecta	DISGYR9E	Definitive	Genetic Variation	[1]
Amelogenesis imperfecta hypomaturation type 2A4	DISOZEXQ	Definitive	Autosomal recessive	[2]
Amelogenesis imperfecta type 2	DISX8NN4	Supportive	Autosomal recessive	[2]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Odontogenesis associated phosphoprotein (ODAPH).	[3]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Odontogenesis associated phosphoprotein (ODAPH).	[4]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Odontogenesis associated phosphoprotein (ODAPH).	[6]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Odontogenesis associated phosphoprotein (ODAPH).	[3]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Odontogenesis associated phosphoprotein (ODAPH).	[5]

References

• [1] Amelogenesis Imperfecta: 1 Family, 2 Phenotypes, and 2 Mutated Genes.J Dent Res. 2016 Dec;95(13):1457-1463. doi: 10.1177/0022034516663200. Epub 2016 Aug 24.
• [2] Mutations in C4orf26, encoding a peptide with in vitro hydroxyapatite crystal nucleation and growth activity, cause amelogenesis imperfecta. Am J Hum Genet. 2012 Sep 7;91(3):565-71. doi: 10.1016/j.ajhg.2012.07.020. Epub 2012 Aug 16.
• [3] Comparative Analysis of Transcriptomic Changes including mRNA and microRNA Expression Induced by the Xenoestrogens Zearalenone and Bisphenol A in Human Ovarian Cells. Toxins (Basel). 2023 Feb 9;15(2):140. doi: 10.3390/toxins15020140.
• [4] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [6] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.