Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTOC5U9H)

DOT Name	IQ domain-containing protein J (IQCJ)
Gene Name	IQCJ
Related Disease	Alzheimer disease ( ) Neuroblastoma ( ) Schizophrenia ( )
UniProt ID	IQCJ_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF15157
Sequence	MRLEELKRLQNPLEQVNDGKYSFENHQLAMDAENNIEKYPLNLQPLESKVKIIQRAWREY LQRQEPLGKRSPSPPSVSSEKLSSSVSMNTFSDSSTPFARAPVGKIHPYISWRLQSPGDK LPGGRKVILLYLDQLARPTGFIHTLKEPQIERLGFLTLQ

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Alzheimer disease	DISF8S70	Strong	Biomarker	[1]
Neuroblastoma	DISVZBI4	Strong	Altered Expression	[2]
Schizophrenia	DISSRV2N	Strong	Biomarker	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of IQ domain-containing protein J (IQCJ).	[3]
------------------------------------------------------------------------------------

References

1	LPS-induced cortical kynurenic acid and neurogranin-NFAT signaling is associated with deficits in stimulus processing during Pavlovian conditioning.J Neuroimmunol. 2017 Dec 15;313:1-9. doi: 10.1016/j.jneuroim.2017.09.010. Epub 2017 Sep 28.
2	Differential expression of MARCKS and other calmodulin-binding protein kinase C substrates in cultured neuroblastoma and glioma cells.J Neurochem. 1994 Dec;63(6):2314-23. doi: 10.1046/j.1471-4159.1994.63062314.x.
3	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.