Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTOPGEY3)

• DOT Name: RNA pseudouridylate synthase domain-containing protein 1 (RPUSD1)
• Synonyms: Ribosomal large subunit pseudouridine synthase C-like protein
• Gene Name: RPUSD1
• UniProt ID: RUSD1_HUMAN
• PDB ID: 5VBB
• Pfam ID: PF00849
• Sequence:
  MEPGSVENLSIVYRSRDFLVVNKHWDVRIDSKAWRETLTLQKQLRYRFPELADPDTCYGF
  RFCHQLDFSTSGALCVALNKAAAGSAYRCFKERRVTKAYLALLRGHIQESRVTISHAIGR
  NSTEGRAHTMCIEGSQGCENPKPSLTDLVVLEHGLYAGDPVSKVLLKPLTGRTHQLRVHC
  SALGHPVVGDLTYGEVSGREDRPFRMMLHAFYLRIPTDTECVEVCTPDPFLPSLDACWSP
  HTLLQSLDQLVQALRATPDPDPEDRGPRPGSPSALLPGPGRPPPPPTKPPETEAQRGPCL
  QWLSEWTLEPDS

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of RNA pseudouridylate synthase domain-containing protein 1 (RPUSD1).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of RNA pseudouridylate synthase domain-containing protein 1 (RPUSD1).	[5]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of RNA pseudouridylate synthase domain-containing protein 1 (RPUSD1).	[2]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of RNA pseudouridylate synthase domain-containing protein 1 (RPUSD1).	[3]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of RNA pseudouridylate synthase domain-containing protein 1 (RPUSD1).	[4]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [3] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [4] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.