Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTORIW79)

DOT Name Immunoglobulin superfamily member 23 (IGSF23)
Gene Name IGSF23
Related Disease
Alzheimer disease ( )
Osteopetrosis ( )
Osteoporosis ( )
UniProt ID
IGS23_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MRAKPQSPLPRNPVPAWSPPTTTTDPMLEKDAAGGDFPANLVLQLMPLKTFPAAIRGVIQ
SELNYSVILQWVVTMDPEPVLSWTFSGVPCGMGEKLFIRRLSCEQLGTYMCIATNSKKQL
VSEPVTISLPKPIMQPTEAEPMEPDPTLSLSGGSAIGLLAAGILGAGALIAGMCFIIIQS
LRTDRQRIGICS
Function May be involved in osteoclast differentiation.
Tissue Specificity Expressed in bone and small intestine . Highly expressed in osteoclasts, and low expressed in osteoblasts and peripheral blood mononuclear cells (PBMCs) .

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Alzheimer disease DISF8S70 Strong Genetic Variation [1]
Osteopetrosis DIS7GHNM Disputed Genetic Variation [2]
Osteoporosis DISF2JE0 Disputed Biomarker [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Immunoglobulin superfamily member 23 (IGSF23). [3]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Immunoglobulin superfamily member 23 (IGSF23). [4]
------------------------------------------------------------------------------------

References

1 Genome-wide meta-analysis identifies new loci and functional pathways influencing Alzheimer's disease risk.Nat Genet. 2019 Mar;51(3):404-413. doi: 10.1038/s41588-018-0311-9. Epub 2019 Jan 7.
2 Osteoclastogenesis inhibition by mutated IGSF23 results in human osteopetrosis.Cell Prolif. 2019 Nov;52(6):e12693. doi: 10.1111/cpr.12693. Epub 2019 Sep 27.
3 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
4 Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.