Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTOTLOZJ)

• DOT Name: Signal-regulatory protein delta (SIRPD)
• Synonyms: SIRP-delta; Protein tyrosine phosphatase non-receptor type substrate 1-like 2
• Gene Name: SIRPD
• Related Disease: Neoplasm
• UniProt ID: SIRPD_HUMAN
• Pfam ID: PF07686
• Sequence:
  MPIPASPLHPPLPSLLLYLLLELAGVTHVFHVQQTEMSQTVSTGESIILSCSVPNTLPNG
  PVLWFKGTGPNRKLIYNFKQGNFPRVKEIGDTTKPGNTDFSTRIREISLADAGTYYCVKF
  IKGRAIKEYQSGRGTQVFVTEQNPRPPKNRPAGRAGSRAHHDAHTCLSALPERNSTNYFV
  QPCCCLRLLGLTGLLSK

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Neoplasm	DISZKGEW	Strong	Biomarker	[1]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Signal-regulatory protein delta (SIRPD).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Signal-regulatory protein delta (SIRPD).	[4]

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Signal-regulatory protein delta (SIRPD).	[3]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of Signal-regulatory protein delta (SIRPD).	[5]

References

• [1] Read-through transcripts in normal human lung parenchyma are down-regulated in lung adenocarcinoma.Oncotarget. 2016 May 10;7(19):27889-98. doi: 10.18632/oncotarget.8556.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [5] Sulforaphane-induced apoptosis in human leukemia HL-60 cells through extrinsic and intrinsic signal pathways and altering associated genes expression assayed by cDNA microarray. Environ Toxicol. 2017 Jan;32(1):311-328.