Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTOZBNIG)

• DOT Name: FXYD domain-containing ion transport regulator 7 (FXYD7)
• Gene Name: FXYD7
• UniProt ID: FXYD7_HUMAN
• Pfam ID: PF02038
• Sequence:
  MATPTQTPTKAPEEPDPFYYDYNTVQTVGMTLATILFLLGILIVISKKVKCRKADSRSES
  PTCKSCKSELPSSAPGGGGV
• Reactome Pathway:
  Ion transport by P-type ATPases (R-HSA-936837)
  Potential therapeutics for SARS (R-HSA-9679191)
  Ion homeostasis (R-HSA-5578775)

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of FXYD domain-containing ion transport regulator 7 (FXYD7).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of FXYD domain-containing ion transport regulator 7 (FXYD7).	[4]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of FXYD domain-containing ion transport regulator 7 (FXYD7).	[2]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of FXYD domain-containing ion transport regulator 7 (FXYD7).	[3]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of FXYD domain-containing ion transport regulator 7 (FXYD7).	[5]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [3] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [5] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.