Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTP9AMYG)

• DOT Name: Outer dense fiber protein 4 (ODF4)
• Synonyms: Outer dense fiber of sperm tails protein 4; Testis-specific protein oppo 1; hOPPO1
• Gene Name: ODF4
• Related Disease:
  Prostate adenocarcinoma
  Prostate cancer
  Prostate carcinoma
  Tarsal-carpal coalition syndrome
  Obsolete male infertility with azoospermia or oligozoospermia due to single gene mutation
• UniProt ID: ODFP4_HUMAN
• Sequence:
  MDAEYSGNEFPRSEGERDQHQRPGKERKSGEAGWGTGELGQDGRLLSSTLSLSSNRSLGQ
  RQNSPLPFQWRITHSFRWMAQVLASELSLVAFILLLVVAFSKKWLDLSRSLFYQRWPVDV
  SNRIHTSAHVMSMGLLHFYKSRSCSDLENGKVTFIFSTLMLFPINIWIFELERNVSIPIG
  WSYFIGWLVLILYFTCAILCYFNHKSFWSLILSHPSGAVSCSSSFGSVEESPRAQTITDT
  PITQEGVLDPEQKDTHV
• Function: Component of the outer dense fibers (ODF) of spermatozoa which could be involved in sperm tail structure, sperm movement and general organization of cellular cytoskeleton.
• Tissue Specificity: Expressed in testis and sperm; especially localized to sperm tail (at protein level).

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Prostate adenocarcinoma	DISBZYU8	Strong	Biomarker	[1]
Prostate cancer	DISF190Y	Strong	Biomarker	[1]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[1]
Tarsal-carpal coalition syndrome	DISY90L2	Strong	Biomarker	[2]
Obsolete male infertility with azoospermia or oligozoospermia due to single gene mutation	DIS56JR8	Moderate	Autosomal recessive	[3]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Outer dense fiber protein 4 (ODF4).	[4]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE	DMNQL17	Investigative	2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE decreases the expression of Outer dense fiber protein 4 (ODF4).	[5]

References

• [1] Expression of splice variants of cancer-testis genes ODF3 and ODF4 in the testis of a prostate cancer patient.Genet Mol Res. 2012 Oct 4;11(4):3642-8. doi: 10.4238/2012.October.4.11.
• [2] Cancer-Testis Antigens as New Candidate Diagnostic Biomarkers for Transitional Cell Carcinoma of Bladder.Pathol Oncol Res. 2019 Jan;25(1):191-199. doi: 10.1007/s12253-017-0313-4. Epub 2017 Oct 20.
• [3] A genomics approach to male infertility. Genet Med. 2020 Dec;22(12):1967-1975. doi: 10.1038/s41436-020-0916-0. Epub 2020 Jul 28.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [5] Preferential induction of the AhR gene battery in HepaRG cells after a single or repeated exposure to heterocyclic aromatic amines. Toxicol Appl Pharmacol. 2010 Nov 15;249(1):91-100.