Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTPGRZLY)

• DOT Name: Keratinocyte differentiation-associated protein (KRTDAP)
• Gene Name: KRTDAP
• Related Disease: Aortic aneurysm
• UniProt ID: KTDAP_HUMAN
• Pfam ID: PF15200
• Sequence:
  MKIPVLPAVVLLSLLVLHSAQGATLGGPEEESTIENYASRPEAFNTPFLNIDKLRSAFKA
  DEFLNWHALFESIKRKLPFLNWDAFPKLKGLRSATPDAQ
• Function: May act as a soluble regulator of keratinocyte differentiation. May play an important role in embryonic skin morphogenesis.
• Tissue Specificity: Highly expressed in skin and detected at lower levels in thymus. In skin, found exclusively in lamellar granules of granular keratinocytes and in the intracellular space of the stratum corneum. Also highly expressed in oral mucosa, tongue, esophagus, and stomach, and at much lower levels in bladder and uterus. Not detected in gastrointestinal mucosa.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Aortic aneurysm	DISQ5KRA	Strong	Biomarker	[1]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Keratinocyte differentiation-associated protein (KRTDAP).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Keratinocyte differentiation-associated protein (KRTDAP).	[3]

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Keratinocyte differentiation-associated protein (KRTDAP).	[4]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Keratinocyte differentiation-associated protein (KRTDAP).	[5]

References

• [1] Exploring the Molecular Mechanism of Thoracic Aortic Aneurysm via Bioinformatics Analysis.Med Sci Monit. 2018 Mar 14;24:1533-1539. doi: 10.12659/msm.905970.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [4] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [5] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.