Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTPM9TZ5)

DOT Name Forkhead box protein S1 (FOXS1)
Synonyms Forkhead-like 18 protein; Forkhead-related transcription factor 10; FREAC-10
Gene Name FOXS1
Related Disease
Breast cancer ( )
Breast carcinoma ( )
Medulloblastoma ( )
Neoplasm ( )
Rhabdomyosarcoma ( )
Gastric cancer ( )
Stomach cancer ( )
UniProt ID
FOXS1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00250
Sequence
MQQQPLPGPGAPTTEPTKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRP
GWQNSIRHNLSLNECFVKVPRDDRKPGKGSYWTLDPDCHDMFEHGSFLRRRRRFTRQTGA
EGTRGPAKARRGPLRATSQDPGVPNATTGRQCSFPPELPDPKGLSFGGLVGAMPASMCPA
TTDGRPRPPMEPKEISTPKPACPGELPVATSSSSCPAFGFPAGFSEAESFNKAPTPVLSP
ESGIGSSYQCRLQALNFCMGADPGLEHLLASAAPSPAPPTPPGSLRAPLPLPTDHKEPWV
AGGFPVQGGSGYPLGLTPCLYRTPGMFFFE
Function Transcriptional repressor that suppresses transcription from the FASLG, FOXO3 and FOXO4 promoters. May have a role in the organization of the testicular vasculature.

Molecular Interaction Atlas (MIA) of This DOT

7 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Breast cancer DIS7DPX1 Strong Altered Expression [1]
Breast carcinoma DIS2UE88 Strong Altered Expression [1]
Medulloblastoma DISZD2ZL Strong Altered Expression [1]
Neoplasm DISZKGEW Strong Altered Expression [2]
Rhabdomyosarcoma DISNR7MS Strong Biomarker [1]
Gastric cancer DISXGOUK Limited Altered Expression [2]
Stomach cancer DISKIJSX Limited Altered Expression [2]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Forkhead box protein S1 (FOXS1). [3]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Forkhead box protein S1 (FOXS1). [6]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Forkhead box protein S1 (FOXS1). [4]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Forkhead box protein S1 (FOXS1). [5]
------------------------------------------------------------------------------------

References

1 Identification of novel GLI1 target genes and regulatory circuits in human cancer cells.Mol Oncol. 2018 Oct;12(10):1718-1734. doi: 10.1002/1878-0261.12366. Epub 2018 Aug 30.
2 FOXS1 is regulated by GLI1 and miR-125a-5p and promotes cell proliferation and EMT in gastric cancer.Sci Rep. 2019 Mar 27;9(1):5281. doi: 10.1038/s41598-019-41717-w.
3 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
4 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
5 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
6 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.