Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTPRR6SK)

DOT Name F-box only protein 39 (FBXO39)
Gene Name FBXO39
Related Disease
Colon cancer ( )
Colon carcinoma ( )
Neoplasm ( )
Advanced cancer ( )
Bone osteosarcoma ( )
Breast cancer ( )
Breast carcinoma ( )
Invasive ductal breast carcinoma ( )
Osteosarcoma ( )
UniProt ID
FBX39_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF12937
Sequence
MDEESELIQPQDQSCWAFLPDLCLCRVFWWLGDRDRSRAALVCRKWNQMMYSAELWRYRT
ITFSGRPSRVHASEVESAVWYVKKFGRYLEHLEVKFMNPYNAVLTKKFQVTMRGLLSCLS
KSNNRLKSLSIQYLELDRLVWRNSIRSSFISSLSFFLKKMGKRLDYLNLKGARLTVEQGC
QILDSLSYMRNENVISELNIEDYFSHHLAVYNSPQFKKTMSTFHNLVSLNLNYNCISDEL
LENLCENASTLRTINIKCHVHDPHGQVIWGMSWAKLARQATNLKVNFFFERIMKYERLAR
ILLQEIPIRSISLRSCYFSDPDCSMRPTLIDLLPTFRHTLQKLTCEFNNNHESLDEELHL
LIISCRKLFYFKIWAFLDVSFVERILKSQKERQCALRVFKARIYTNRYETNEEDKTLQEI
YRKYRKLIESELSYFVIVYSVM
Function Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.

Molecular Interaction Atlas (MIA) of This DOT

9 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Colon cancer DISVC52G Strong Biomarker [1]
Colon carcinoma DISJYKUO Strong Biomarker [1]
Neoplasm DISZKGEW Strong Altered Expression [2]
Advanced cancer DISAT1Z9 Limited Biomarker [3]
Bone osteosarcoma DIST1004 Limited Biomarker [4]
Breast cancer DIS7DPX1 Limited Biomarker [3]
Breast carcinoma DIS2UE88 Limited Biomarker [3]
Invasive ductal breast carcinoma DIS43J58 Limited Altered Expression [3]
Osteosarcoma DISLQ7E2 Limited Biomarker [4]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 1 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
NAPQI DM8F5LR Investigative F-box only protein 39 (FBXO39) affects the response to substance of NAPQI. [6]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of F-box only protein 39 (FBXO39). [5]
------------------------------------------------------------------------------------

References

1 Identification of BCP-20 (FBXO39) as a cancer/testis antigen from colon cancer patients by SEREX.Biochem Biophys Res Commun. 2011 May 6;408(2):195-201. doi: 10.1016/j.bbrc.2011.02.077. Epub 2011 Feb 19.
2 Expression of Cancer Testis Antigens in Colorectal Cancer: New Prognostic and Therapeutic Implications.Dis Markers. 2016;2016:1987505. doi: 10.1155/2016/1987505. Epub 2016 Aug 18.
3 Expression analysis of two cancer-testis genes, FBXO39 and TDRD4, in breast cancer tissues and cell lines.Asian Pac J Cancer Prev. 2014 Jan;14(11):6625-9. doi: 10.7314/apjcp.2013.14.11.6625.
4 Knockdown of FBXO39 inhibits proliferation and promotes apoptosis of human osteosarcoma U-2OS cells.Oncol Lett. 2018 Aug;16(2):1849-1854. doi: 10.3892/ol.2018.8876. Epub 2018 Jun 1.
5 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
6 Acetaminophen-NAPQI hepatotoxicity: a cell line model system genome-wide association study. Toxicol Sci. 2011 Mar;120(1):33-41. doi: 10.1093/toxsci/kfq375. Epub 2010 Dec 22.