Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTPVXSWY)

• DOT Name: UPF0711 protein C18orf21 (C18ORF21)
• Synonyms: HBV X-transactivated gene 13 protein; HBV XAg-transactivated protein 13
• Gene Name: C18ORF21
• UniProt ID: CR021_HUMAN
• Pfam ID: PF15719
• Sequence:
  MRQKHYLEAAARGLHDSCPGQARYLLWAYTSSHDDKSTFEETCPYCFQLLVLDNSRVRLK
  PKARLTPKIQKLLNREARNYTLSFKEAKMVKKFKDSKSVLLITCKTCNRTVKHHGKSRSF
  VSTLKSNPATPTSKLSLKTPERRTANPNHDMSGSKGKSPASVFRTPTSGQSVSTCSSKNT
  SKTKKHFSQLKMLLSQNESQKIPKVDFRNFLSSLKGGLLK

Molecular Interaction Atlas (MIA) of This DOT

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of UPF0711 protein C18orf21 (C18ORF21).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of UPF0711 protein C18orf21 (C18ORF21).	[2]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of UPF0711 protein C18orf21 (C18ORF21).	[3]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate decreases the expression of UPF0711 protein C18orf21 (C18ORF21).	[4]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of UPF0711 protein C18orf21 (C18ORF21).	[5]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Coumarin	DM0N8ZM	Investigative	Coumarin increases the phosphorylation of UPF0711 protein C18orf21 (C18ORF21).	[6]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [4] CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
• [5] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [6] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.