Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTPXKZTX)

DOT Name	Ropporin-1A (ROPN1)
Synonyms	Cancer/testis antigen 91; CT91; Rhophilin-associated protein 1A
Gene Name	ROPN1
Related Disease	High blood pressure ( ) Neoplasm ( )
UniProt ID	ROP1A_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MAQTDKPTCIPPELPKMLKEFAKAAIRVQPQDLIQWAADYFEALSRGETPPVRERSERVA LCNRAELTPELLKILHSQVAGRLIIRAEELAQMWKVVNLPTDLFNSVMNVGRFTEEIEWL KFLALACSALGVTITKTLKIVCEVLSCDHNGGSPRIPFSTFQFLYTYIAKVDGEISASHV SRMLNYMEQEVIGPDGIITVNDFTQNPRVQLE
Function	Important for male fertility. With ROPN1L, involved in fibrous sheath integrity and sperm motility, plays a role in PKA-dependent signaling processes required for spermatozoa capacitation.
Tissue Specificity	Testis specific in adult. Overexpressed in hematologic tumor cells.
Reactome Pathway	RHO GTPases Activate Rhotekin and Rhophilins (R-HSA-5666185 )

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
High blood pressure	DISY2OHH	Strong	Genetic Variation	[1]
Neoplasm	DISZKGEW	Disputed	Altered Expression	[2]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Etoposide	DMNH3PG	Approved	Ropporin-1A (ROPN1) affects the response to substance of Etoposide.	[4]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Ropporin-1A (ROPN1).	[3]
------------------------------------------------------------------------------------

References

1	Kalirin: a novel genetic risk factor for ischemic stroke.Hum Genet. 2010 Mar;127(5):513-23. doi: 10.1007/s00439-010-0790-y. Epub 2010 Jan 28.
2	A yeast two-hybrid system using Sp17 identified Ropporin as a novel cancer-testis antigen in hematologic malignancies.Int J Cancer. 2007 Oct 1;121(7):1507-11. doi: 10.1002/ijc.22842.
3	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
4	Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.