Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQ190TS)

• DOT Name: Putative SEC14-like protein 6 (SEC14L6)
• Gene Name: SEC14L6
• Related Disease: Acute myelogenous leukaemia
• UniProt ID: S14L6_HUMAN
• Pfam ID: PF00650
• Sequence:
  MSGQVGDLSPSQEKSLAQFRENIQDVLSALPNPDDYFLLRWLQARSFDLQKSEDMLRKHM
  EFRKQQDLANILAWQPPEVVRLYNANGICGHDGEGSPVWYHIVGSLDPKGLLLSASKQEL
  LRDSFRSCELLLRECELQSQKLGKRVEKIIAIFGLEGLGLRDLWKPGIELLQEFFSALEA
  NYPEILKSLIVVRAPKLFAVAFNLVKSYMSEETRRKVVILGDNWKQELTKFISPDQLPVE
  FGGTMTDPDGNPKCLTKINYGGEVPKSYYLCKQVRLQYEHTRSVGRGSSLQVENEILFPG
  CVLRWQFASDGGDIGFGVFLKTKMGERQRAREMTEVLPSQRYNAHMVPEDGILTCLQAGS
  YVLRFYNTYSLVHSKRISYTVEVLLPDQTFMEKMEKF

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Acute myelogenous leukaemia	DISCSPTN	moderate	Genetic Variation	[1]

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Malathion	DMXZ84M	Approved	Malathion decreases the expression of Putative SEC14-like protein 6 (SEC14L6).	[2]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Putative SEC14-like protein 6 (SEC14L6).	[3]

References

• [1] Genome-wide haplotype association study identify the FGFR2 gene as a risk gene for acute myeloid leukemia.Oncotarget. 2017 Jan 31;8(5):7891-7899. doi: 10.18632/oncotarget.13631.
• [2] Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
• [3] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.