Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQ1R3JD)

DOT Name	Trafficking regulator of GLUT4 1 (TRARG1)
Synonyms	Dispanin subfamily B member 1; DSPB1; Interferon-induced transmembrane domain-containing protein D3; Protein located at seventeen-p-thirteen point three 1; Tumor suppressor candidate 5
Gene Name	TRARG1
Related Disease	Hepatocellular carcinoma ( ) Neoplasm ( ) Breast cancer ( ) Breast carcinoma ( ) Lung cancer ( ) Lung carcinoma ( )
UniProt ID	TARG1_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF04505
Sequence	MAHPVQSEFPSAQEPGSAAFLDLPEMEILLTKAENKDDKTLNLSKTLSGPLDLEQNSQGL PFKAISEGHLEAPLPRSPSRASSRRASSIATTSYAQDQEAPRDYLILAVVACFCPVWPLN LIPLIISIMSRSSMQQGNVDGARRLGRLARLLSITLIIMGIVIIMVAVTVNFTVQKK
Function	Regulates insulin-mediated adipose tissue glucose uptake and transport by modulation of SLC2A4 recycling. Not required for SLC2A4 membrane fusion upon an initial stimulus, but rather is necessary for proper protein recycling during prolonged insulin stimulation.
Tissue Specificity	Expressed at high levels in heart, mammary gland, adrenal gland, stomach, smooth muscle and skeletal muscle, and at lower levels in brain and lung. Strongly down-regulated in lung cancer tissues, due to hypermethylation of the corresponding locus . Expressed in adipose tissue .

Molecular Interaction Atlas (MIA) of This DOT

6 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Hepatocellular carcinoma	DIS0J828	Definitive	Biomarker	[1]
Neoplasm	DISZKGEW	Definitive	Biomarker	[1]
Breast cancer	DIS7DPX1	Strong	Biomarker	[2]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[2]
Lung cancer	DISCM4YA	Strong	Altered Expression	[3]
Lung carcinoma	DISTR26C	Strong	Altered Expression	[3]
------------------------------------------------------------------------------------


⏷ Show the Full List of 6 Disease(s)

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Trafficking regulator of GLUT4 1 (TRARG1).	[4]
------------------------------------------------------------------------------------

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Trafficking regulator of GLUT4 1 (TRARG1).	[5]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Trafficking regulator of GLUT4 1 (TRARG1).	[6]
------------------------------------------------------------------------------------

References

1	Dysregulation of miR484-TUSC5 axis takes part in the progression of hepatocellular carcinoma.J Biochem. 2019 Sep 1;166(3):271-279. doi: 10.1093/jb/mvz034.
2	miR-3188 Regulates Cell Proliferation, Apoptosis, and Migration in Breast Cancer by Targeting TUSC5 and Regulating the p38 MAPK Signaling Pathway.Oncol Res. 2018 Apr 10;26(3):363-372. doi: 10.3727/096504017X14953948675421. Epub 2017 May 26.
3	Detailed characterization of a homozygously deleted region corresponding to a candidate tumor suppressor locus at distal 17p13.3 in human lung cancer.Oncogene. 2003 Mar 27;22(12):1892-905. doi: 10.1038/sj.onc.1206304.
4	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
5	Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
6	Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.