Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQF3C4I)

• DOT Name: Protein NATD1 (NATD1)
• Synonyms: N-acetyltransferase domain-containing protein 1
• Gene Name: NATD1
• UniProt ID: NATD1_HUMAN
• Pfam ID: PF14542
• Sequence:
  MAHSAAAVPLGALEQGCPIRVEHDRRRRQFTVRLNGCHDRAVLLYEYVGKRIVDLQHTEV
  PDAYRGRGIAKHLAKAALDFVVEEDLKAHLTCWYIQKYVKENPLPQYLERLQP

Molecular Interaction Atlas (MIA) of This DOT

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Protein NATD1 (NATD1).	[1]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Protein NATD1 (NATD1).	[2]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Protein NATD1 (NATD1).	[3]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Protein NATD1 (NATD1).	[4]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Protein NATD1 (NATD1).	[5]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Protein NATD1 (NATD1).	[7]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of Protein NATD1 (NATD1).	[9]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Protein NATD1 (NATD1).	[6]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Protein NATD1 (NATD1).	[8]

References

• [1] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [2] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [3] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [4] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [5] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [6] Effect of aflatoxin B(1), benzo[a]pyrene, and methapyrilene on transcriptomic and epigenetic alterations in human liver HepaRG cells. Food Chem Toxicol. 2018 Nov;121:214-223. doi: 10.1016/j.fct.2018.08.034. Epub 2018 Aug 26.
• [7] Targeting MYCN in neuroblastoma by BET bromodomain inhibition. Cancer Discov. 2013 Mar;3(3):308-23.
• [8] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [9] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.