Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQHGP0S)

DOT Name Cancer/testis antigen 47A (CT47A11)
Synonyms Cancer/testis antigen 47; CT47
Gene Name CT47A11
Related Disease
Breast cancer ( )
Breast carcinoma ( )
Carcinoma of esophagus ( )
Colorectal carcinoma ( )
Esophageal cancer ( )
Lung cancer ( )
Lung carcinoma ( )
Lung neoplasm ( )
Neoplasm of esophagus ( )
UniProt ID
CT47A_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF15623
Sequence
MSATGDRHPTQGDQEAPVSQEGAQAEAAGAGNQEGGDSGPDSSDVVPAAEVVGVAGPVEG
LGEEEGEQAAGLAAVPRGGSAEEDSDIGPATEEEEEEEGNEAANFDLAVVARRYPASGIH
FVLLDMVHSLLHRLSHNDHILIENRQLSRLMVGPHAAARNLWGNLPPLLLPQRLGAGAAA
RAGEGLGLIQEAASVPEPAVPADLAEMAREPAEEAAEEKLSEEATEEPDAEEPATEEPTA
QEATAPEEVTKSQPEKWDEEAQDAAGEEEKEQEKEKDAENKVKNSKGT
Tissue Specificity Strongly expressed in testis, low expression in placenta, and very low expression in brain.

Molecular Interaction Atlas (MIA) of This DOT

9 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Breast cancer DIS7DPX1 Strong Altered Expression [1]
Breast carcinoma DIS2UE88 Strong Altered Expression [1]
Carcinoma of esophagus DISS6G4D Strong Altered Expression [1]
Colorectal carcinoma DIS5PYL0 Strong Altered Expression [1]
Esophageal cancer DISGB2VN Strong Altered Expression [1]
Lung cancer DISCM4YA Strong Altered Expression [1]
Lung carcinoma DISTR26C Strong Altered Expression [1]
Lung neoplasm DISVARNB Strong Altered Expression [1]
Neoplasm of esophagus DISOLKAQ Strong Altered Expression [1]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate affects the expression of Cancer/testis antigen 47A (CT47A11). [2]
------------------------------------------------------------------------------------

References

1 Identification of a new cancer/testis gene family, CT47, among expressed multicopy genes on the human X chromosome.Genes Chromosomes Cancer. 2006 Apr;45(4):392-400. doi: 10.1002/gcc.20298.
2 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.