Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQMBFNS)

• DOT Name: Transmembrane protein 238 (TMEM238)
• Gene Name: TMEM238
• UniProt ID: TM238_HUMAN
• Pfam ID: PF15125
• Sequence:
  MAAAPAVCASQGSPPGAPSAPAAAPAPAAGLGRCRMALLLAVALDVAGMAALLTGVFAQL
  QVRGRDFGDLLIYSGALLVFLSLLGWILWYTGNIEISRQELERDYGLRPSALARLARKLS
  RRWSAPAAAGQRPAPGSRRARRAARAPPPPAAGSRRVRLQLATLEAGPGAAGAGSE

Molecular Interaction Atlas (MIA) of This DOT

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Transmembrane protein 238 (TMEM238).	[1]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Transmembrane protein 238 (TMEM238).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Transmembrane protein 238 (TMEM238).	[3]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Transmembrane protein 238 (TMEM238).	[4]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Transmembrane protein 238 (TMEM238).	[5]

References

• [1] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [2] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [3] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [4] Bisphenolic compounds alter gene expression in MCF-7 cells through interaction with estrogen receptor . Toxicol Appl Pharmacol. 2020 Jul 15;399:115030. doi: 10.1016/j.taap.2020.115030. Epub 2020 May 6.
• [5] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.