Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQWXHEJ)

• DOT Name: Anaphase-promoting complex subunit 13 (ANAPC13)
• Synonyms: APC13; Cyclosome subunit 13
• Gene Name: ANAPC13
• Related Disease: Chronic pancreatitis
• UniProt ID: APC13_HUMAN
• PDB ID: 4UI9; 5G04; 5KHR; 5KHU; 5L9T; 5L9U; 5LCW; 6Q6G; 6Q6H; 6TLJ; 6TM5; 6TNT; 7QE7; 8PKP; 8TAR; 8TAU
• Pfam ID: PF05839
• Sequence:
  MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDL
  ALQYLHENVPPIGN
• Function: Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains.
• KEGG Pathway:
  Cell cycle (hsa04110)
  Oocyte meiosis (hsa04114)
  Ubiquitin mediated proteolysis (hsa04120)
  Progesterone-mediated oocyte maturation (hsa04914)
  Human T-cell leukemia virus 1 infection (hsa05166)
• Reactome Pathway: Antigen processing (R-HSA-983168)

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Chronic pancreatitis	DISBUOMJ	Limited	Biomarker	[1]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of Anaphase-promoting complex subunit 13 (ANAPC13).	[2]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Anaphase-promoting complex subunit 13 (ANAPC13).	[3]
AMEP	DMFELMQ	Phase 1	AMEP increases the expression of Anaphase-promoting complex subunit 13 (ANAPC13).	[4]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the expression of Anaphase-promoting complex subunit 13 (ANAPC13).	[5]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Anaphase-promoting complex subunit 13 (ANAPC13).	[6]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Anaphase-promoting complex subunit 13 (ANAPC13).	[7]
Glyphosate	DM0AFY7	Investigative	Glyphosate decreases the expression of Anaphase-promoting complex subunit 13 (ANAPC13).	[4]
Okadaic acid	DM47CO1	Investigative	Okadaic acid decreases the expression of Anaphase-promoting complex subunit 13 (ANAPC13).	[8]

References

• [1] Identifying miRNA-mRNA regulation network of chronic pancreatitis based on the significant functional expression.Medicine (Baltimore). 2017 May;96(21):e6668. doi: 10.1097/MD.0000000000006668.
• [2] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [3] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [4] Glyphosate-based herbicides at low doses affect canonical pathways in estrogen positive and negative breast cancer cell lines. PLoS One. 2019 Jul 11;14(7):e0219610. doi: 10.1371/journal.pone.0219610. eCollection 2019.
• [5] Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.
• [6] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [7] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [8] The marine toxin okadaic acid induces alterations in the expression level of cancer-related genes in human neuronal cells. Ecotoxicol Environ Saf. 2013 Jun;92:303-11. doi: 10.1016/j.ecoenv.2013.03.009. Epub 2013 Apr 3.