| DOT Name |
Proteasome subunit alpha-type 8 (PSMA8)
|
| Synonyms |
Proteasome alpha 4 subunit; Alpha4s; Proteasome subunit alpha-type 7-like |
| Gene Name |
PSMA8
|
| Related Disease |
- Colorectal carcinoma ( )
- Male infertility ( )
|
| UniProt ID |
|
| 3D Structure |
|
| Pfam ID |
|
| Sequence |
MASRYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGIRGTNIVVLGVEKKSVAKLQDERT
VRKICALDDHVCMAFAVLTIFIGLTADARVVINRARVECQSHKLTVEDPVTVEYITRFIA
TLKQKYTQSNGRRPFGISALIVGFDDDGISRLYQTDPSGTYHAWKANAIGRSAKTVREFL
EKNYTEDAIASDSEAIKLAIKALLEVVQSGGKNIELAIIRRNQPLKMFSAKEVELYVTEI
EKEKEEAEKKKSKKSV
|
| Function |
Component of the spermatoproteasome, a proteasome specifically found in testis that promotes acetylation-dependent degradation of histones, thereby participating actively to the exchange of histones during spermatogenesis. The proteasome is a protein complex that degrades unneeded or damaged proteins by proteolysis, a chemical reaction that breaks peptide bonds. Required for 20S core proteasome assembly, essential for the degradation of meiotic proteins RAD51 and RPA1 at late prophase I and the progression of meiosis I during spermatogenesis. Localizes to the synaptonemal complex, a 'zipper'-like structure that holds homologous chromosome pairs in synapsis during meiotic prophase I.
|
| KEGG Pathway |
- Proteasome (hsa03050 )
- Alzheimer disease (hsa05010 )
- Parkinson disease (hsa05012 )
- Amyotrophic lateral sclerosis (hsa05014 )
- Huntington disease (hsa05016 )
- Spinocerebellar ataxia (hsa05017 )
- Prion disease (hsa05020 )
- Pathways of neurodegeneration - multiple diseases (hsa05022 )
|
| Reactome Pathway |
- Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha (R-HSA-1234176 )
- ER-Phagosome pathway (R-HSA-1236974 )
- Cross-presentation of soluble exogenous antigens (endosomes) (R-HSA-1236978 )
- SCF-beta-TrCP mediated degradation of Emi1 (R-HSA-174113 )
- APC/C (R-HSA-174154 )
- APC/C (R-HSA-174178 )
- Cdc20 (R-HSA-174184 )
- Vpu mediated degradation of CD4 (R-HSA-180534 )
- Vif-mediated degradation of APOBEC3G (R-HSA-180585 )
- Degradation of beta-catenin by the destruction complex (R-HSA-195253 )
- Downstream TCR signaling (R-HSA-202424 )
- Regulation of activated PAK-2p34 by proteasome mediated degradation (R-HSA-211733 )
- Separation of Sister Chromatids (R-HSA-2467813 )
- FCERI mediated NF-kB activation (R-HSA-2871837 )
- Autodegradation of the E3 ubiquitin ligase COP1 (R-HSA-349425 )
- Regulation of ornithine decarboxylase (ODC) (R-HSA-350562 )
- ABC-family proteins mediated transport (R-HSA-382556 )
- AUF1 (hnRNP D0) binds and destabilizes mRNA (R-HSA-450408 )
- Asymmetric localization of PCP proteins (R-HSA-4608870 )
- Degradation of AXIN (R-HSA-4641257 )
- Degradation of DVL (R-HSA-4641258 )
- Hedgehog ligand biogenesis (R-HSA-5358346 )
- Hh mutants are degraded by ERAD (R-HSA-5362768 )
- Dectin-1 mediated noncanonical NF-kB signaling (R-HSA-5607761 )
- CLEC7A (Dectin-1) signaling (R-HSA-5607764 )
- Degradation of GLI1 by the proteasome (R-HSA-5610780 )
- Degradation of GLI2 by the proteasome (R-HSA-5610783 )
- GLI3 is processed to GLI3R by the proteasome (R-HSA-5610785 )
- Hedgehog 'on' state (R-HSA-5632684 )
- Regulation of RAS by GAPs (R-HSA-5658442 )
- TNFR2 non-canonical NF-kB pathway (R-HSA-5668541 )
- NIK-->noncanonical NF-kB signaling (R-HSA-5676590 )
- Defective CFTR causes cystic fibrosis (R-HSA-5678895 )
- MAPK6/MAPK4 signaling (R-HSA-5687128 )
- UCH proteinases (R-HSA-5689603 )
- Ub-specific processing proteases (R-HSA-5689880 )
- Orc1 removal from chromatin (R-HSA-68949 )
- CDK-mediated phosphorylation and removal of Cdc6 (R-HSA-69017 )
- G2/M Checkpoints (R-HSA-69481 )
- Ubiquitin Mediated Degradation of Phosphorylated Cdc25A (R-HSA-69601 )
- Ubiquitin-dependent degradation of Cyclin D (R-HSA-75815 )
- The role of GTSE1 in G2/M progression after G2 checkpoint (R-HSA-8852276 )
- FBXL7 down-regulates AURKA during mitotic entry and in early mitosis (R-HSA-8854050 )
- RUNX1 regulates transcription of genes involved in differentiation of HSCs (R-HSA-8939236 )
- Regulation of RUNX2 expression and activity (R-HSA-8939902 )
- Regulation of PTEN stability and activity (R-HSA-8948751 )
- Neddylation (R-HSA-8951664 )
- Regulation of expression of SLITs and ROBOs (R-HSA-9010553 )
- Interleukin-1 signaling (R-HSA-9020702 )
- KEAP1-NFE2L2 pathway (R-HSA-9755511 )
- Antigen processing (R-HSA-983168 )
- Activation of NF-kappaB in B cells (R-HSA-1169091 )
|
|
|
|
|
|
|
