Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTRAJ80C)

DOT Name	G antigen 2A (GAGE2A)
Synonyms	GAGE-2A
Gene Name	GAGE2A
Related Disease	Lung cancer ( ) Melanoma ( ) Urinary bladder neoplasm ( )
UniProt ID	GAG2A_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF05831
Sequence	MSWRGRSTYRPRPRRYVEPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGQD EGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Lung cancer	DISCM4YA	Strong	Altered Expression	[1]
Melanoma	DIS1RRCY	Strong	Altered Expression	[1]
Urinary bladder neoplasm	DIS7HACE	Strong	Altered Expression	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Mitoxantrone	DMM39BF	Approved	G antigen 2A (GAGE2A) affects the response to substance of Mitoxantrone.	[2]
------------------------------------------------------------------------------------

References

1	A new family of genes coding for an antigen recognized by autologous cytolytic T lymphocytes on a human melanoma.J Exp Med. 1995 Sep 1;182(3):689-98. doi: 10.1084/jem.182.3.689.
2	Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.