Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTRG82L2)

DOT Name	Peroxisomal testis-specific protein 1 (PXT1)
Synonyms	Small testis-specific peroxisomal protein
Gene Name	PXT1
Related Disease	Male infertility ( ) Multiple sclerosis ( )
UniProt ID	PXT1_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	7WJH; 8GSV
Pfam ID	PF15214
Sequence	MKKKHDGIVYETKEVLNPSPKVTHCCKSLWLKYSFQKAYMTQLVSSQPVPAMSRNPDHNL LSQPKEHSIVQKHHQEEIIHKLAMQLRHIGDNIDHRMVREDLQQDGRDALDHFVFFFFRR VQVLLHFFWNNHLL

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Male infertility	DISY3YZZ	Strong	Altered Expression	[1]
Multiple sclerosis	DISB2WZI	Strong	Genetic Variation	[2]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Peroxisomal testis-specific protein 1 (PXT1).	[3]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Peroxisomal testis-specific protein 1 (PXT1).	[3]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Peroxisomal testis-specific protein 1 (PXT1).	[4]
------------------------------------------------------------------------------------

References

1	Overexpression of peroxisomal testis-specific 1 protein induces germ cell apoptosis and leads to infertility in male mice.Mol Biol Cell. 2011 May 15;22(10):1766-79. doi: 10.1091/mbc.E09-12-0993. Epub 2011 Apr 1.
2	Analysis of immune-related loci identifies 48 new susceptibility variants for multiple sclerosis.Nat Genet. 2013 Nov;45(11):1353-60. doi: 10.1038/ng.2770. Epub 2013 Sep 29.
3	Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
4	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.