Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTRGL3O1)
DOT Name | Small integral membrane protein 6 (SMIM6) | ||||
---|---|---|---|---|---|
Gene Name | SMIM6 | ||||
UniProt ID | |||||
3D Structure | |||||
Sequence |
MDQLVFKETIWNDAFWQNPWDQGGLAVIILFITAVLLLILFAIVFGLLTSTENTQCEAGE
EE |
||||
KEGG Pathway | |||||
Molecular Interaction Atlas (MIA) of This DOT
Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
5 Drug(s) Affected the Gene/Protein Processing of This DOT
|
|||||||||||||||||||||||||||||||||||||||||||||
1 Drug(s) Affected the Post-Translational Modifications of This DOT
|
|||||||||||||||||||||||||||||||||||||||||||||
References