Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTRGL3O1)

DOT Name Small integral membrane protein 6 (SMIM6)
Gene Name SMIM6
UniProt ID
SMIM6_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MDQLVFKETIWNDAFWQNPWDQGGLAVIILFITAVLLLILFAIVFGLLTSTENTQCEAGE
EE
KEGG Pathway
Calcium sig.ling pathway (hsa04020 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
5 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Small integral membrane protein 6 (SMIM6). [1]
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Small integral membrane protein 6 (SMIM6). [2]
Triclosan DMZUR4N Approved Triclosan increases the expression of Small integral membrane protein 6 (SMIM6). [3]
Ethinyl estradiol DMODJ40 Approved Ethinyl estradiol affects the expression of Small integral membrane protein 6 (SMIM6). [4]
Genistein DM0JETC Phase 2/3 Genistein affects the expression of Small integral membrane protein 6 (SMIM6). [4]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Small integral membrane protein 6 (SMIM6). [5]
------------------------------------------------------------------------------------

References

1 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
3 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
4 Dose- and time-dependent transcriptional response of Ishikawa cells exposed to genistein. Toxicol Sci. 2016 May;151(1):71-87.
5 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.