Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTRX4NOT)

DOT Name Fez family zinc finger protein 1 (FEZF1)
Synonyms Zinc finger protein 312B
Gene Name FEZF1
Related Disease
Advanced cancer ( )
Attention deficit hyperactivity disorder ( )
Cervical cancer ( )
Cervical carcinoma ( )
Gastric cancer ( )
Glioma ( )
Hypoactive sexual desire disorder ( )
Hypogonadotropic hypogonadism 22 with or without anosmia ( )
Neoplasm ( )
Non-small-cell lung cancer ( )
Stomach cancer ( )
Colorectal carcinoma ( )
Kallmann syndrome ( )
Matthew-Wood syndrome ( )
Pancreatic ductal carcinoma ( )
UniProt ID
FEZF1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00096 ; PF13912
Sequence
MDSSCHNATTKMLATAPARGNMMSTSKPLAFSIERIMARTPEPKALPVPHFLQGALPKGE
PKHSLHLNSSIPCMIPFVPVAYDTSPKAGVTGSEPRKASLEAPAAPAAVPSAPAFSCSDL
LNCALSLKGDLARDALPLQQYKLVRPRVVNHSSFHAMGALCYLNRGDGPCHPAAGVNIHP
VASYFLSSPLHPQPKTYLAERNKLVVPAVEKYPSGVAFKDLSQAQLQHYMKESAQLLSEK
IAFKTSDFSRGSPNAKPKVFTCEVCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQA
STLCRHKIIHTQEKPHKCNQCGKAFNRSSTLNTHTRIHAGYKPFVCEFCGKGFHQKGNYK
NHKLTHSGEKQFKCNICNKAFHQVYNLTFHMHTHNDKKPFTCPTCGKGFCRNFDLKKHVR
KLHDSSLGLARTPAGEPGTEPPPPLPQQPPMTLPPLQPPLPTPGPLQPGLHQGHQ
Function
Transcription repressor. Involved in the axonal projection and proper termination of olfactory sensory neurons (OSN). Plays a role in rostro-caudal patterning of the diencephalon and in prethalamic formation. Expression is required in OSN to cell-autonomously regulate OSN axon projections. Regulates non-cell-autonomously the layer formation of the olfactory bulb development and the interneurons. May be required for correct rostral migration of the interneuron progenitors.
Tissue Specificity Expressed in brain. Little or no expression in other tissues. Overexpressed specifically in gastric cancers. A 2- to 20-fold increase is found in over 50% of gastric cancer tissues.

Molecular Interaction Atlas (MIA) of This DOT

15 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Advanced cancer DISAT1Z9 Strong Altered Expression [1]
Attention deficit hyperactivity disorder DISL8MX9 Strong Biomarker [2]
Cervical cancer DISFSHPF Strong Biomarker [3]
Cervical carcinoma DIST4S00 Strong Biomarker [3]
Gastric cancer DISXGOUK Strong Altered Expression [4]
Glioma DIS5RPEH Strong Biomarker [5]
Hypoactive sexual desire disorder DISGYLY2 Strong Biomarker [6]
Hypogonadotropic hypogonadism 22 with or without anosmia DISL8JC1 Strong Autosomal recessive [7]
Neoplasm DISZKGEW Strong Altered Expression [3]
Non-small-cell lung cancer DIS5Y6R9 Strong Altered Expression [8]
Stomach cancer DISKIJSX Strong Altered Expression [4]
Colorectal carcinoma DIS5PYL0 moderate Altered Expression [9]
Kallmann syndrome DISO3HDG Supportive Autosomal dominant [7]
Matthew-Wood syndrome DISA7HR7 Limited Biomarker [10]
Pancreatic ductal carcinoma DIS26F9Q Limited Biomarker [10]
------------------------------------------------------------------------------------
⏷ Show the Full List of 15 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Fez family zinc finger protein 1 (FEZF1). [11]
------------------------------------------------------------------------------------

References

1 Prognostic value of lncRNA FEZF1 antisense RNA 1 over-expression in oncologic outcomes of patients with solid tumors.Medicine (Baltimore). 2019 Jun;98(24):e15982. doi: 10.1097/MD.0000000000015982.
2 Gene-based analysis of ADHD using PASCAL: a biological insight into the novel associated genes.BMC Med Genomics. 2019 Oct 24;12(1):143. doi: 10.1186/s12920-019-0593-5.
3 FEZF1 is an Independent Predictive Factor for Recurrence and Promotes Cell Proliferation and Migration in Cervical Cancer.J Cancer. 2018 Oct 10;9(21):3929-3938. doi: 10.7150/jca.26073. eCollection 2018.
4 Circulatinglong non-coding RNA FEZF1-AS1 and AFAP1-AS1 serve as potential diagnostic biomarkers for gastric cancer.Pathol Res Pract. 2020 Jan;216(1):152757. doi: 10.1016/j.prp.2019.152757. Epub 2019 Nov 22.
5 Over-Expressed FEZF1 Predicts a Poor Prognosis in Glioma and Promotes Glioma Cell Malignant Biological Properties by Regulating Akt-ERK Pathway.J Mol Neurosci. 2018 Aug;65(4):411-419. doi: 10.1007/s12031-018-1108-0. Epub 2018 Jul 20.
6 Fezf1 is a novel regulator of female sex behavior in mice.Horm Behav. 2018 Jan;97:94-101. doi: 10.1016/j.yhbeh.2017.10.010. Epub 2017 Nov 14.
7 Mutations in FEZF1 cause Kallmann syndrome. Am J Hum Genet. 2014 Sep 4;95(3):326-31. doi: 10.1016/j.ajhg.2014.08.006.
8 Upregulation of LncRNA FEZF-AS1 is associated with advanced clinical stages and family history of cancer in patients with NSCLC.Pathol Res Pract. 2018 Jun;214(6):857-861. doi: 10.1016/j.prp.2018.04.014. Epub 2018 Apr 24.
9 Long noncoding RNA FEZF1-AS1 in human cancers.Clin Chim Acta. 2019 Oct;497:20-26. doi: 10.1016/j.cca.2019.07.004. Epub 2019 Jul 2.
10 FEZF1-AS1/miR-107/ZNF312B axis facilitates progression and Warburg effect in pancreatic ductal adenocarcinoma.Cell Death Dis. 2018 Jan 18;9(2):34. doi: 10.1038/s41419-017-0052-1.
11 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.