Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTTB2N9F)

DOT Name Metallothionein 1H-like protein 1 (MT1HL1)
Gene Name MT1HL1
UniProt ID
M1BL1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00131
Sequence
MDPNCSCAAGGSYACAGSCKCKKCKCTSCKKSCCSCCPLGCAKCAQGCIRKGASEKCSCC
A
Function Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.
KEGG Pathway
Mineral absorption (hsa04978 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
8 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Metallothionein 1H-like protein 1 (MT1HL1). [1]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Metallothionein 1H-like protein 1 (MT1HL1). [2]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of Metallothionein 1H-like protein 1 (MT1HL1). [3]
Demecolcine DMCZQGK Approved Demecolcine increases the expression of Metallothionein 1H-like protein 1 (MT1HL1). [4]
Acetic Acid, Glacial DM4SJ5Y Approved Acetic Acid, Glacial increases the expression of Metallothionein 1H-like protein 1 (MT1HL1). [5]
Motexafin gadolinium DMEJKRF Approved Motexafin gadolinium increases the expression of Metallothionein 1H-like protein 1 (MT1HL1). [6]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Metallothionein 1H-like protein 1 (MT1HL1). [7]
Lead acetate DML0GZ2 Investigative Lead acetate increases the expression of Metallothionein 1H-like protein 1 (MT1HL1). [8]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Drug(s)

References

1 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
2 Long-term estrogen exposure promotes carcinogen bioactivation, induces persistent changes in gene expression, and enhances the tumorigenicity of MCF-7 human breast cancer cells. Toxicol Appl Pharmacol. 2009 Nov 1;240(3):355-66.
3 Changes in gene expression profiles of multiple myeloma cells induced by arsenic trioxide (ATO): possible mechanisms to explain ATO resistance in vivo. Br J Haematol. 2005 Mar;128(5):636-44.
4 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
5 Motexafin gadolinium and zinc induce oxidative stress responses and apoptosis in B-cell lymphoma lines. Cancer Res. 2005 Dec 15;65(24):11676-88.
6 Motexafin gadolinium disrupts zinc metabolism in human cancer cell lines. Cancer Res. 2005 May 1;65(9):3837-45.
7 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
8 Analysis of lead toxicity in human cells. BMC Genomics. 2012 Jul 27;13:344.