Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTTF4YB1)

DOT Name	rRNA methyltransferase 3, mitochondrial (MRM3)
Synonyms	EC 2.1.1.-; 16S rRNA (guanosine(1370)-2'-O)-methyltransferase; 16S rRNA 2'-O-methyltransferase; RNA methyltransferase-like protein 1
Gene Name	MRM3
UniProt ID	MRM3_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	7OI6
EC Number	2.1.1.-
Pfam ID	PF00588
Sequence	MAALVRPARFVVRPLLQVVQAWDLDARRWVRALRRSPVKVVFPSGEVVEQKRAPGKQPRK APSEASAQEQREKQPLEESASRAPSTWEESGLRYDKAYPGDRRLSSVMTIVKSRPFREKQ GKILLEGRRLISDALKAGAVPKMFFFSRLEYLKELPVDKLKGVSLIKVKFEDIKDWSDLV TPQGIMGIFAKPDHVKMTYPKTQLQHSLPLLLICDNLRDPGNLGTILRSAAGAGCSKVLL TKGCVDAWEPKVLRAGMGAHFRMPIINNLEWETVPNYLPPDTRVYVADNCGLYAQAEMSN KASDHGWVCDQRVMKFHKYEEEEDVETGASQDWLPHVEVQSYDSDWTEAPAAVVIGGETY GVSLESLQLAESTGGKRLLIPVVPGVDSLNSAMAASILLFEGKRQLRGRAEDLSRDRSYH
Function	S-adenosyl-L-methionine-dependent 2'-O-ribose methyltransferase that catalyzes the formation of 2'-O-methylguanosine at position 1370 (Gm1370) in the 16S mitochondrial large subunit ribosomal RNA (mtLSU rRNA), a conserved modification in the peptidyl transferase domain of the mtLSU rRNA.
Tissue Specificity	Expressed at same level in normal liver and hepatocarcinoma.
Reactome Pathway	rRNA modification in the mitochondrion (R-HSA-6793080 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of rRNA methyltransferase 3, mitochondrial (MRM3).	[1]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of rRNA methyltransferase 3, mitochondrial (MRM3).	[2]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of rRNA methyltransferase 3, mitochondrial (MRM3).	[3]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of rRNA methyltransferase 3, mitochondrial (MRM3).	[4]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of rRNA methyltransferase 3, mitochondrial (MRM3).	[5]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of rRNA methyltransferase 3, mitochondrial (MRM3).	[6]
------------------------------------------------------------------------------------

References

1	Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
2	Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
3	Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
4	Quantitative proteomics and transcriptomics addressing the estrogen receptor subtype-mediated effects in T47D breast cancer cells exposed to the phytoestrogen genistein. Mol Cell Proteomics. 2011 Jan;10(1):M110.002170.
5	Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
6	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.