| DOT Name |
Ribosomal protein uL3-like (RPL3L)
|
| Synonyms |
60S ribosomal protein L3-like; Large ribosomal subunit protein uL3-like |
| Gene Name |
RPL3L
|
| Related Disease |
- Autosomal dominant polycystic kidney disease ( )
- Atrial fibrillation ( )
- Cardiomyopathy, dilated, 2D ( )
- Familial atrial fibrillation ( )
- Dilated cardiomyopathy ( )
|
| UniProt ID |
|
| 3D Structure |
|
| Pfam ID |
|
| Sequence |
MSHRKFSAPRHGHLGFLPHKRSHRHRGKVKTWPRDDPSQPVHLTAFLGYKAGMTHTLREV
HRPGLKISKREEVEAVTIVETPPLVVVGVVGYVATPRGLRSFKTIFAEHLSDECRRRFYK
DWHKSKKKAFTKACKRWRDTDGKKQLQKDFAAMKKYCKVIRVIVHTQMKLLPFRQKKAHI
MEIQLNGGTVAEKVAWAQARLEKQVPVHSVFSQSEVIDVIAVTKGRGVKGVTSRWHTKKL
PRKTHKGLRKVACIGAWHPARVGCSIARAGQKGYHHRTELNKKIFRIGRGPHMEDGKLVK
NNASTSYDVTAKSITPLGGFPHYGEVNNDFVMLKGCIAGTKKRVITLRKSLLVHHSRQAV
ENIELKFIDTTSKFGHGRFQTAQEKRAFMGPQKKHLEKETPETSGDL
|
| Function |
Heart- and skeletal muscle-specific component of the ribosome, which regulates muscle function. Component of the large ribosomal subunit in striated muscle cells: replaces the RPL3 paralog in the ribosome in these cells. The ribosome is a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell. Inhibits myotube growth and muscle function.
|
| KEGG Pathway |
- Ribosome (hsa03010 )
- Coro.virus disease - COVID-19 (hsa05171 )
|
| Reactome Pathway |
- Peptide chain elongation (R-HSA-156902 )
- SRP-dependent cotranslational protein targeting to membrane (R-HSA-1799339 )
- Viral mRNA Translation (R-HSA-192823 )
- Selenocysteine synthesis (R-HSA-2408557 )
- Major pathway of rRNA processing in the nucleolus and cytosol (R-HSA-6791226 )
- Formation of a pool of free 40S subunits (R-HSA-72689 )
- GTP hydrolysis and joining of the 60S ribosomal subunit (R-HSA-72706 )
- Eukaryotic Translation Termination (R-HSA-72764 )
- Regulation of expression of SLITs and ROBOs (R-HSA-9010553 )
- Response of EIF2AK4 (GCN2) to amino acid deficiency (R-HSA-9633012 )
- Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC) (R-HSA-975956 )
- Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC) (R-HSA-975957 )
- L13a-mediated translational silencing of Ceruloplasmin expression (R-HSA-156827 )
|
|
|
|
|
|
|
