Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTTWVUDE)

DOT Name	Transmembrane protein 212 (TMEM212)
Gene Name	TMEM212
Related Disease	High blood pressure ( )
UniProt ID	TM212_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MKGLYQAAGRILVTLGILSVCSGVIAFFPVFSYKPWFTGWSVRIACPIWNGALAITTGVL LLLAYREWTQRYLGEATFTFVILSIMGCPLHFAIALESALLGPYCFYSFSGIAGTNYLGY AVTFPYPYAKFPLACVDPPHYEEYHLTLQALDLCLSFTLLCTSLTVFIKLSARLIQNGHI NMQLPAGNPNPFSP

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance		REF
High blood pressure	DISY2OHH	Strong	Genetic Variation	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Transmembrane protein 212 (TMEM212).	[2]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Transmembrane protein 212 (TMEM212).	[3]
------------------------------------------------------------------------------------

References

1	Genomic association analysis identifies multiple loci influencing antihypertensive response to an angiotensin II receptor blocker.Hypertension. 2012 Jun;59(6):1204-11. doi: 10.1161/HYP.0b013e31825b30f8. Epub 2012 May 7.
2	The DNA methyltransferase inhibitors azacitidine, decitabine and zebularine exert differential effects on cancer gene expression in acute myeloid leukemia cells. Leukemia. 2009 Jun;23(6):1019-28.
3	Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.