Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTTX8AH1)

• DOT Name: Small integral membrane protein 22 (SMIM22)
• Synonyms: Cancer-associated small integral membrane open reading frame 1
• Gene Name: SMIM22
• Related Disease:
  Breast cancer
  Breast carcinoma
  Breast neoplasm
• UniProt ID: SIM22_HUMAN
• Pfam ID: PF15831
• Sequence:
  MAVSTEELEATVQEVLGRLKSHQFFQSTWDTVAFIVFLTFMGTVLLLLLLVVAHCCCCSS
  PGPRRESPRKERPKGVDNLALEP
• Function: May modulate lipid droplet formation throught interaction with SQLE.

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Breast cancer	DIS7DPX1	Strong	Biomarker	[1]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[1]
Breast neoplasm	DISNGJLM	Strong	Altered Expression	[1]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Small integral membrane protein 22 (SMIM22).	[2]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Small integral membrane protein 22 (SMIM22).	[3]
Permethrin	DMZ0Q1G	Approved	Permethrin increases the expression of Small integral membrane protein 22 (SMIM22).	[4]

References

• [1] The cancer-associated microprotein CASIMO1 controls cell proliferation and interacts with squalene epoxidase modulating lipid droplet formation.Oncogene. 2018 Aug;37(34):4750-4768. doi: 10.1038/s41388-018-0281-5. Epub 2018 May 16.
• [2] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [3] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [4] Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.