Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTTY4K6K)

• DOT Name: Acyl-CoA-binding domain-containing protein 7 (ACBD7)
• Gene Name: ACBD7
• UniProt ID: ACBD7_HUMAN
• PDB ID: 3EPY
• Pfam ID: PF00887
• Sequence:
  MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAW
  NLKKGLSTEDATSAYISKAKELIEKYGI
• Function: Binds medium- and long-chain acyl-CoA esters.
• Reactome Pathway: Mitochondrial Fatty Acid Beta-Oxidation (R-HSA-77289)

Molecular Interaction Atlas (MIA) of This DOT

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Acyl-CoA-binding domain-containing protein 7 (ACBD7).	[1]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Acyl-CoA-binding domain-containing protein 7 (ACBD7).	[2]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Acyl-CoA-binding domain-containing protein 7 (ACBD7).	[4]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Acyl-CoA-binding domain-containing protein 7 (ACBD7).	[4]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Acyl-CoA-binding domain-containing protein 7 (ACBD7).	[5]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Acyl-CoA-binding domain-containing protein 7 (ACBD7).	[6]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Acyl-CoA-binding domain-containing protein 7 (ACBD7).	[7]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Acyl-CoA-binding domain-containing protein 7 (ACBD7).	[8]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Acyl-CoA-binding domain-containing protein 7 (ACBD7).	[9]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate decreases the expression of Acyl-CoA-binding domain-containing protein 7 (ACBD7).	[10]
QUERCITRIN	DM1DH96	Investigative	QUERCITRIN increases the expression of Acyl-CoA-binding domain-containing protein 7 (ACBD7).	[11]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Acyl-CoA-binding domain-containing protein 7 (ACBD7).	[3]

References

• [1] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [2] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [3] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [4] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [5] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [6] BET bromodomain inhibition targets both c-Myc and IL7R in high-risk acute lymphoblastic leukemia. Blood. 2012 Oct 4;120(14):2843-52.
• [7] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [8] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [9] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [10] Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.
• [11] Molecular mechanisms of quercitrin-induced apoptosis in non-small cell lung cancer. Arch Med Res. 2014 Aug;45(6):445-54.