Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUAOBWK)

• DOT Name: Mitochondrial import receptor subunit TOM6 homolog (TOMM6)
• Synonyms: Overexpressed breast tumor protein; Translocase of outer membrane 6 kDa subunit homolog
• Gene Name: TOMM6
• UniProt ID: TOM6_HUMAN
• PDB ID: 7CK6; 7CP9; 7VBY; 7VC4; 7VD2; 7VDD
• Pfam ID: PF15184
• Sequence:
  MASSTVPVSAAGSANETPEIPDNVGDWLRGVYRFATDRNDFRRNLILNLGLFAAGVWLAR
  NLSDIDLMAPQPGV
• Reactome Pathway:
  PINK1-PRKN Mediated Mitophagy (R-HSA-5205685)
  Mitochondrial protein import (R-HSA-1268020)

Molecular Interaction Atlas (MIA) of This DOT

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of Mitochondrial import receptor subunit TOM6 homolog (TOMM6).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Mitochondrial import receptor subunit TOM6 homolog (TOMM6).	[2]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Mitochondrial import receptor subunit TOM6 homolog (TOMM6).	[3]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Mitochondrial import receptor subunit TOM6 homolog (TOMM6).	[4]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Mitochondrial import receptor subunit TOM6 homolog (TOMM6).	[6]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the expression of Mitochondrial import receptor subunit TOM6 homolog (TOMM6).	[8]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Mitochondrial import receptor subunit TOM6 homolog (TOMM6).	[9]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Mitochondrial import receptor subunit TOM6 homolog (TOMM6).	[10]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Mitochondrial import receptor subunit TOM6 homolog (TOMM6).	[5]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Mitochondrial import receptor subunit TOM6 homolog (TOMM6).	[7]

References

• [1] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [4] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [5] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [6] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [7] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [8] Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.
• [9] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [10] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.