Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUH6J9L)

• DOT Name: Epidermal growth factor-like protein 7 (EGFL7)
• Synonyms: EGF-like protein 7; Multiple epidermal growth factor-like domains protein 7; Multiple EGF-like domains protein 7; NOTCH4-like protein; Vascular endothelial statin; VE-statin; Zneu1
• Gene Name: EGFL7
• UniProt ID: EGFL7_HUMAN
• Pfam ID: PF07974 ; PF07546 ; PF14670
• Sequence:
  MRGSQEVLLMWLLVLAVGGTEHAYRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHR
  ACSTYRTIYRTAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQP
  GRCRCPAGWRGDTCQSDVDECSARRGGCPQRCVNTAGSYWCQCWEGHSLSADGTLCVPKG
  GPPRVAPNPTGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLL
  VHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDS
• Function: Regulates vascular tubulogenesis in vivo. Inhibits platelet-derived growth factor (PDGF)-BB-induced smooth muscle cell migration and promotes endothelial cell adhesion to the extracellular matrix and angiogenesis.

Molecular Interaction Atlas (MIA) of This DOT

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Epidermal growth factor-like protein 7 (EGFL7).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Epidermal growth factor-like protein 7 (EGFL7).	[6]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the phosphorylation of Epidermal growth factor-like protein 7 (EGFL7).	[7]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Epidermal growth factor-like protein 7 (EGFL7).	[8]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Epidermal growth factor-like protein 7 (EGFL7).	[2]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Epidermal growth factor-like protein 7 (EGFL7).	[3]
Sodium phenylbutyrate	DMXLBCQ	Approved	Sodium phenylbutyrate increases the expression of Epidermal growth factor-like protein 7 (EGFL7).	[4]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Epidermal growth factor-like protein 7 (EGFL7).	[5]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Mechanism of miR-222 and miR-126 regulation and its role in asbestos-induced malignancy. Int J Biochem Cell Biol. 2020 Apr;121:105700. doi: 10.1016/j.biocel.2020.105700. Epub 2020 Feb 4.
• [3] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [4] Epigenetic therapy upregulates the tumor suppressor microRNA-126 and its host gene EGFL7 in human cancer cells. Biochem Biophys Res Commun. 2009 Feb 13;379(3):726-31. doi: 10.1016/j.bbrc.2008.12.098. Epub 2008 Dec 29.
• [5] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [7] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [8] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.