Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUL6GWP)

DOT Name	Putative uncharacterized protein C19orf73 (C19ORF73)
Gene Name	C19ORF73
UniProt ID	CS073_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF17692
Sequence	MRLKVGFQGGGCFRKDALCLEGGVSARWARAPHSAPLRPPRELHAAPPPATPTQTVVRPA GFPRRTRLMVRSAPPTQRPPTGSGCVSGLWRKGLGLRPQTLLRVGSVVLSSAPALRPRLG PCLRPPPSD

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Putative uncharacterized protein C19orf73 (C19ORF73).	[1]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Putative uncharacterized protein C19orf73 (C19ORF73).	[2]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Putative uncharacterized protein C19orf73 (C19ORF73).	[3]
------------------------------------------------------------------------------------

References

1	Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
2	Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
3	Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.