Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTURDYCZ)

DOT Name	Transmembrane protein 82 (TMEM82)
Gene Name	TMEM82
Related Disease	Carcinoma of liver and intrahepatic biliary tract ( ) Liver cancer ( )
UniProt ID	TMM82_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF15816
Sequence	MFSLPSLPSWLPGLPSLEWGSSLLDSLLQGLIGALGVLVLNSLLKVYFFVGCANDPQRRP EKERLRAQWASLETVHLAGLALFLTVVGSRVAALVVLEFSLRAVSTLLSLGKGSQGAAER LQLYLLCQYSLGCGLTCGLSFLQEGAPHRTLNLLLSLGLATLLGLGARRLHRHVCRLYEL HSSQRYCGVCLGLLAHAHGLPQLLGRALAIAFAVGDLAAVALINQDFLTTSEAMRFWTPL TICYTLLVIYMQEEQRQHPGLQSQVQTVLVRMGGLFVLLLTVGRWLDLLGILVSLLGELW CLVGVRTLLDLCQIQDFPSQRPPVSTPSQPLPSAPQSQSSAPS

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Strong	Altered Expression	[1]
Liver cancer	DISDE4BI	Strong	Altered Expression	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Transmembrane protein 82 (TMEM82).	[2]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Transmembrane protein 82 (TMEM82).	[3]
------------------------------------------------------------------------------------

References

1	Identification of latent biomarkers in hepatocellular carcinoma by ultra-deep whole-transcriptome sequencing.Oncogene. 2014 Sep 25;33(39):4786-94. doi: 10.1038/onc.2013.424. Epub 2013 Oct 21.
2	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3	Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.