Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTV7PQJF)

• DOT Name: Gametocyte-specific factor 1 (GTSF1)
• Synonyms: Protein FAM112B
• Gene Name: GTSF1
• Related Disease:
  Carcinoma of liver and intrahepatic biliary tract
  Hepatocellular carcinoma
  Liver cancer
  Neoplasm
  Cryptorchidism
  Primary cutaneous T-cell lymphoma
• UniProt ID: GTSF1_HUMAN
• Pfam ID: PF05253
• Sequence:
  MEETYTDSLDPEKLLQCPYDKNHQIRACRFPYHLIKCRKNHPDVASKLATCPFNARHQVP
  RAEISHHISSCDDRSCIEQDVVNQTRSLRQETLAESTWQCPPCDEDWDKDLWEQTSTPFV
  WGTTHYSDNNSPASNIVTEHKNNLASGMRVPKSLPYVLPWKNNGNAQ
• Function: Required for spermatogenesis and is involved in the suppression of retrotransposon transcription in male germ cells.

Molecular Interaction Atlas (MIA) of This DOT

6 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Disputed	Altered Expression	[1]
Hepatocellular carcinoma	DIS0J828	Disputed	Altered Expression	[1]
Liver cancer	DISDE4BI	Disputed	Altered Expression	[1]
Neoplasm	DISZKGEW	Disputed	Biomarker	[1]
Cryptorchidism	DISYUD2P	Limited	Altered Expression	[2]
Primary cutaneous T-cell lymphoma	DIS35WVW	Limited	Altered Expression	[3]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Gametocyte-specific factor 1 (GTSF1).	[4]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Gametocyte-specific factor 1 (GTSF1).	[6]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Gametocyte-specific factor 1 (GTSF1).	[5]

References

• [1] GTSF1 gene may serve as a novel potential diagnostic biomarker for liver cancer.Oncol Lett. 2018 Mar;15(3):3133-3140. doi: 10.3892/ol.2017.7695. Epub 2017 Dec 27.
• [2] Piwi-pathway alteration induces LINE-1 transposon derepression and infertility development in cryptorchidism.Sex Dev. 2015;9(2):98-104. doi: 10.1159/000375351. Epub 2015 Mar 13.
• [3] Ectopic expression of cancer-testis antigens in cutaneous T-cell lymphoma patients.Clin Cancer Res. 2014 Jul 15;20(14):3799-808. doi: 10.1158/1078-0432.CCR-14-0307. Epub 2014 May 21.
• [4] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [5] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.