Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTVEF1CJ)

• DOT Name: Protein adenylyltransferase SelO, mitochondrial (SELENOO)
• Synonyms: EC 2.7.7.-; EC 2.7.7.108; Selenoprotein O; SelO
• Gene Name: SELENOO
• UniProt ID: SELO_HUMAN
• EC Number: 2.7.7.-; 2.7.7.108
• Pfam ID: PF02696
• Sequence:
  MAVYRAALGASLAAARLLPLGRCSPSPAPRSTLSGAAMEPAPRWLAGLRFDNRALRALPV
  EAPPPGPEGAPSAPRPVPGACFTRVQPTPLRQPRLVALSEPALALLGLGAPPAREAEAEA
  ALFFSGNALLPGAEPAAHCYCGHQFGQFAGQLGDGAAMYLGEVCTATGERWELQLKGAGP
  TPFSRQADGRKVLRSSIREFLCSEAMFHLGVPTTRAGACVTSESTVVRDVFYDGNPKYEQ
  CTVVLRVASTFIRFGSFEIFKSADEHTGRAGPSVGRNDIRVQLLDYVISSFYPEIQAAHA
  SDSVQRNAAFFREVTRRTARMVAEWQCVGFCHGVLNTDNMSILGLTIDYGPFGFLDRYDP
  DHVCNASDNTGRYAYSKQPEVCRWNLRKLAEALQPELPLELGEAILAEEFDAEFQRHYLQ
  KMRRKLGLVQVELEEDGALVSKLLETMHLTGADFTNTFYLLSSFPVELESPGLAEFLARL
  MEQCASLEELRLAFRPQMDPRQLSMMLMLAQSNPQLFALMGTRAGIARELERVEQQSRLE
  QLSAAELQSRNQGHWADWLQAYRARLDKDLEGAGDAAAWQAEHVRVMHANNPKYVLRNYI
  AQNAIEAAERGDFSEVRRVLKLLETPYHCEAGAATDAEATEADGADGRQRSYSSKPPLWA
  AELCVTUSS
• Function: Catalyzes the transfer of adenosine 5'-monophosphate (AMP) to Ser, Thr and Tyr residues of target proteins (AMPylation). May be a redox-active mitochondrial selenoprotein which interacts with a redox target protein.
• BioCyc Pathway: MetaCyc:ENSG00000073169-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Protein adenylyltransferase SelO, mitochondrial (SELENOO).	[1]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Protein adenylyltransferase SelO, mitochondrial (SELENOO).	[6]

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Protein adenylyltransferase SelO, mitochondrial (SELENOO).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Protein adenylyltransferase SelO, mitochondrial (SELENOO).	[3]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Protein adenylyltransferase SelO, mitochondrial (SELENOO).	[4]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Protein adenylyltransferase SelO, mitochondrial (SELENOO).	[5]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Protein adenylyltransferase SelO, mitochondrial (SELENOO).	[2]
BRN-3548355	DM4KXT0	Investigative	BRN-3548355 increases the expression of Protein adenylyltransferase SelO, mitochondrial (SELENOO).	[7]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [4] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [5] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [6] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [7] Gene expression profiles in HPV-immortalized human cervical cells treated with the nicotine-derived carcinogen 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone. Chem Biol Interact. 2009 Feb 12;177(3):173-80. doi: 10.1016/j.cbi.2008.10.051. Epub 2008 Nov 6.