Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTVFKZXV)

• DOT Name: Mitochondrial carrier protein SCaMC-3L (SLC25A41)
• Synonyms: Mitochondrial ATP-Mg/Pi carrier protein SLC25A41; Small calcium-binding mitochondrial carrier protein 3-like; SCaMC-3-like; SCaMC-3L; Solute carrier family 25 member 41
• Gene Name: SLC25A41
• Related Disease:
  Cytomegalovirus infection
  Breast cancer
  Breast carcinoma
• UniProt ID: S2541_HUMAN
• Pfam ID: PF00153
• Sequence:
  MGAQPGEPQNTCSRIQTLFRRVKTLLIKAPPPPQPPPPPPSWNPGCTHVYGYAFGHMHDN
  NLEHLPSQQVLDTGEQLMVPVEVLEVDNKEALWKFLLSGAMAGAVSRTGTAPLDRAKVYM
  QVYSSKTNFTNLLGGLQSMVQEGGFRSLWRGNGINVLKIAPEYAIKFSVFEQCKNYFCGI
  QGSPPFQERLLAGSLAVAISQTLINPMEVLKTRLTLRRTGQYKGLLDCARQILQREGTRA
  LYRGYLPNMLGIIPYACTDLAVYEMLQCFWVKSGRDMGDPSGLVSLSSVTLSTTCGQMAS
  YPLTLVRTRMQAQDTVEGSNPTMRGVLQRILAQQGWLGLYRGMTPTLLKVLPAGGISYVV
  YEAMKKTLGI
• Function: Calcium-independent ATP-Mg/Pi exchanger that catalyzes the electroneutral exchange of Mg-ATP or free ADP against an hydrogenphosphate and participates in the net transport of adenine nucleotides across the mitochondria inner membrane.

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Cytomegalovirus infection	DISCEMGC	Strong	Biomarker	[1]
Breast cancer	DIS7DPX1	Limited	Altered Expression	[2]
Breast carcinoma	DIS2UE88	Limited	Altered Expression	[2]

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Mitochondrial carrier protein SCaMC-3L (SLC25A41).	[3]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Mitochondrial carrier protein SCaMC-3L (SLC25A41).	[4]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Mitochondrial carrier protein SCaMC-3L (SLC25A41).	[5]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Mitochondrial carrier protein SCaMC-3L (SLC25A41).	[6]

References

• [1] Inactivation and disassembly of the anaphase-promoting complex during human cytomegalovirus infection is associated with degradation of the APC5 and APC4 subunits and does not require UL97-mediated phosphorylation of Cdh1.J Virol. 2010 Oct;84(20):10832-43. doi: 10.1128/JVI.01260-10. Epub 2010 Aug 4.
• [2] MicroRNA-452 contributes to the docetaxel resistance of breast cancer cells.Tumour Biol. 2014 Jul;35(7):6327-34. doi: 10.1007/s13277-014-1834-z. Epub 2014 Mar 20.
• [3] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [4] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [6] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.